octT Resolved · medium auto-curated

H37Rv Rv2418c · MTBC0 mtbc0_002574 · 247 aa · 2740663–2741406 (-) · RefSeq NP_216934.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationdiglucosylglycerate octanoyltransferase
Revised (this work)Diglucosylglycerate octanoyltransferase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71725 SwissProt · reviewed · Evidence at protein level
UniProt nameDiglucosylglycerate octanoyltransferase
EC (curated) EC 2.3.1.273
Curated functionSugar octanoyltransferase likely involved in the biosynthesis of mycobacterial methylglucose lipopolysaccharide (MGLP). Catalyzes the transfer of an octanoyl group from octanoyl-CoA to the C6 OH of the second glucose in diglucosylglycerate (DGG). DGG is the preferred acceptor, but to a lesser extent, GG (glucosylglycerate) can also be used as substrate. DGG and GG are the two earliest intermediates in MGLP biosynthesis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameoctT
eggNOG descriptionSugar octanoyltransferase likely involved in the biosynthesis of mycobacterial methylglucose lipopolysaccharide (MGLP). Catalyzes the transfer of an octanoyl group from octanoyl- CoA to the C6 OH of the second glucose in diglucosylglycerate (DGG)
Orthologous groupCOG2755
Gene Ontology (25) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0008374, GO:0009987, GO:0016020, GO:0016043, GO:0016414, GO:0016415 +13 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gpgP (glucosyl-3-phosphoglycerate phosphatase), high confidence from genomic context alone (score 901 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2419c gpgP glucosyl-3-phosphoglycerate phosphatase 982 901 ctx neighborhood:882 textmining:828
Rv2420c rsfS hyp hypothetical protein 889 889 ctx neighborhood:882
Rv2421c nadD nicotinate-nucleotide adenylyltransferase 887 887 ctx neighborhood:882
Rv2417c DegV domain-containing protein 973 797 ctx neighborhood:786 textmining:875
Rv2186c hyp hypothetical protein 778 778 ctx cooccurence:772
Rv2695 hyp hypothetical protein 779 771 ctx cooccurence:764
Rv3415c hyp hypothetical protein 771 771 ctx cooccurence:770
Rv3031 1,4-alpha-glucan-branching protein 907 761 ctx cooccurence:760 textmining:627
Rv3212 hyp hypothetical protein 752 753 ctx cooccurence:736
Rv1109c hyp hypothetical protein 752 752 ctx cooccurence:752
Rv0383c ttfA hyp hypothetical protein 750 750 ctx cooccurence:750
Rv2732c transmembrane protein 749 749 ctx cooccurence:742
Rv3438 hyp hypothetical protein 750 739 ctx cooccurence:737
Rv3034c acetyltransferase 945 731 ctx cooccurence:721 textmining:807
Rv3311 hyp hypothetical protein 730 730 ctx cooccurence:727

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: diglucosylglycerate octanoyltransferase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216934.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2755
  • Curated reference: UniProt P71725 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 107 functional partner(s); context anchor gpgP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002574|Rv2418c|octT
MSSRRGRRPALLVFADSLAYYGPTGGLPADDPRIWPNIVASQLDWDLELIGRIGWTCRDVWWAATQDPRAWAALPRAGAVIFATGGMDSLPSVLPTALRELIRYVRPSWLRRWVRDGYAWVQPRLSPVARAALPPHLTAEYLEKTRGAIDFNRPGIPIIASLPSVHIAETYGKAHHGRAGTVAAITEWAQHHDIPLVDLKAAVAEQILSGYGNRDGIHWNFEAHQAVAELMLKALAEAGVPNEKSRG