lprD Still unknown · low auto-curated

H37Rv Rv1343c · MTBC0 mtbc0_001440 · 126 aa · 1519245–1519625 (-) · RefSeq NP_215859.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LprD
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK51 SwissProt · reviewed · Inferred from homology
UniProt namePutative lipoprotein LprD

UniProt still lists this protein as Putative lipoprotein LprD; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namelprD
eggNOG descriptionGlucitol operon activator
Orthologous groupCOG1566

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.993 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2446c (integral membrane protein), high confidence from genomic context alone (score 746 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1342c hyp hypothetical protein 888 888 ctx neighborhood:882
Rv3850 hyp hypothetical protein 753 753 ctx cooccurence:696
Rv2446c integral membrane protein 746 746 ctx cooccurence:746
Rv0049 hyp hypothetical protein 734 735 ctx cooccurence:731
Rv0358 hyp hypothetical protein 733 734 ctx cooccurence:733
Rv1209 hyp hypothetical protein 721 721 ctx cooccurence:710
Rv0556 transmembrane protein 719 719 ctx cooccurence:719
Rv3205c hyp hypothetical protein 712 712 ctx cooccurence:711
Rv3438 hyp hypothetical protein 704 704 ctx cooccurence:701
Rv2732c transmembrane protein 693 694 ctx cooccurence:693
Rv3605c hyp hypothetical protein 689 689 ctx cooccurence:689
Rv1632c hyp hypothetical protein 684 684 ctx cooccurence:683
Rv1332 transcriptional regulator 678 678 ctx cooccurence:678
Rv0863 hyp hypothetical protein 673 673 ctx cooccurence:672
Rv3256c hyp hypothetical protein 671 671 ctx cooccurence:671

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LprD
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215859.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1566
  • Curated reference: UniProt P9WK51 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 108 functional partner(s); context anchor Rv2446c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001440|Rv1343c|lprD
MSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARKQNRTTA