bioD Resolved · high auto-curated

H37Rv Rv1570 · MTBC0 mtbc0_001678 · 226 aa · 1789823–1790503 (+) · RefSeq NP_216086.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP-dependent dethiobiotin synthetase BioD
MTBC0 PGAP re-annotationdethiobiotin synthase
Revised (this work)Dethiobiotin synthase. Pfam: AAA_26 (PF13500.13), CbiA (PF01656.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPQ5 SwissProt · reviewed · Evidence at protein level
UniProt nameDethiobiotin synthetase BioD
EC (curated) EC 6.3.3.3
Curated functionCatalyzes a mechanistically unusual reaction, the ATP-dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA, also called 7,8-diammoniononanoate) to form a ureido ring. Can use a range of NTPs; has highest affinity for CTP (KD is measured as 17.2 uM or 0.160 uM in 2 different papers) while KD for ATP is 331 uM or 75 uM in the same papers. Gly-169 plays a role in NTP discrimination.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namebioD
eggNOG descriptionCatalyzes a mechanistically unusual reaction, the ATP- dependent insertion of CO2 between the N7 and N8 nitrogen atoms of 7,8-diaminopelargonic acid (DAPA) to form an ureido ring
Orthologous groupCOG0132
EC number EC 6.3.3.3
KEGG orthology K01935
KEGG pathways map00780, map01100
KEGG modules M00123, M00573, M00577
Gene Ontology (75) GO:0000166, GO:0000287, GO:0003674, GO:0003824, GO:0004141, GO:0005488, GO:0005524, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829 +63 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.529 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_26PF13500.13 4.2e-274–187 AAA domain
CbiAPF01656.30 3.6e-074–99 CobQ/CobB/MinD/ParA nucleotide binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bioA (adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1568 bioA adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA 999 999 ctx neighborhood:881 cooccurence:762 coexpression:695 database:900 textmining:965
Rv1589 bioB biotin synthetase 999 997 ctx cooccurence:770 coexpression:856 database:900 textmining:954
Rv1569 bioF1 8-amino-7-oxononanoate synthase 999 990 ctx neighborhood:882 cooccurence:711 coexpression:723 textmining:964
Rv1571 hyp hypothetical protein 990 953 ctx neighborhood:882 coexpression:615 textmining:806
Rv0032 bioF2 8-amino-7-oxononanoate synthase 931 869 ctx cooccurence:513 coexpression:709 textmining:500
Rv2208 cobS adenosylcobinamide-GDP ribazoletransferase 776 747 coexpression:746
Rv1567c membrane protein 741 741 ctx neighborhood:741
Rv3329 aminotransferase 743 710 coexpression:693
Rv1563c treY maltooligosyl trehalose synthase 626 626 ctx neighborhood:623
Rv2524c fas fatty acid synthase 678 546 ctx neighborhood:544
Rv1590 hyp hypothetical protein 521 500
Rv1286 cysC adenylyl-sulfate kinase 447 448 coexpression:441
Rv1596 nadC nicotinate-nucleotide pyrophosphatase 547 426
Rv2392 cysH phosphoadenosine phosphosulfate reductase 401 402 coexpression:402
Rv1505c hyp hypothetical protein 430 401 coexpression:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP-dependent dethiobiotin synthetase BioD
  • MTBC0 PGAP product: dethiobiotin synthase
  • Pfam (hmmscan --cut_ga): AAA_26 PF13500.13 (E=4e-27), CbiA PF01656.30 (E=4e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216086.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_26 (PF13500.13), CbiA (PF01656.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0132
  • Curated reference: UniProt P9WPQ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor bioA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001678|Rv1570|bioD
MTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIATVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG