bioF1 Resolved · high auto-curated

H37Rv Rv1569 · MTBC0 - · 386 aa · 1776702–1777862 (+) · RefSeq YP_177822.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)8-amino-7-oxononanoate synthase
MTBC0 PGAP re-annotation
Revised (this work)8-amino-7-oxononanoate synthase. Pfam: Aminotran_1_2 (PF00155.28), Aminotran_5 (PF00266.26), DegT_DnrJ_EryC1 (PF01041.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WQ87 SwissProt · reviewed · Evidence at protein level
UniProt name8-amino-7-oxononanoate synthase 1
EC (curated) EC 2.3.1.47
Curated functionCatalyzes the decarboxylative condensation of pimeloyl-[acyl-carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier protein], and carbon dioxide (By similarity). Can also use pimeloyl-CoA instead of pimeloyl-ACP as substrate. To a lesser extent, can also utilize D-alanine instead of L-alanine as substrate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namebioF
eggNOG descriptionCatalyzes the decarboxylative condensation of pimeloyl- acyl-carrier protein and L-alanine to produce 8-amino-7- oxononanoate (AON), acyl-carrier protein , and carbon dioxide
Orthologous groupCOG0156
EC number EC 2.3.1.47, EC 6.2.1.14
KEGG orthology K00652, K01906
KEGG pathways map00780, map01100
KEGG modules M00123, M00573, M00577
Gene Ontology (55) GO:0003674, GO:0003824, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006732, GO:0006766, GO:0006767, GO:0006768, GO:0006790 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.546 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aminotran_1_2PF00155.28 1.9e-5843–374 Aminotransferase class I and II
Aminotran_5PF00266.26 1.0e-0681–210 Aminotransferase class-V
DegT_DnrJ_EryC1PF01041.24 3.1e-0685–217 DegT/DnrJ/EryC1/StrS aminotransferase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bioA (adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1568 bioA adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA 999 998 ctx neighborhood:881 cooccurence:667 coexpression:473 database:900 textmining:946
Rv1570 bioD ATP-dependent dethiobiotin synthetase BioD 999 990 ctx neighborhood:882 cooccurence:711 coexpression:723 textmining:964
Rv0032 bioF2 8-amino-7-oxononanoate synthase 932 918 database:900
Rv1589 bioB biotin synthetase 990 910 ctx cooccurence:629 coexpression:672 textmining:902
Rv1571 hyp hypothetical protein 985 895 ctx neighborhood:882 textmining:870
Rv1567c membrane protein 741 741 ctx neighborhood:741
Rv1563c treY maltooligosyl trehalose synthase 625 625 ctx neighborhood:623
Rv2211c gcvT aminomethyltransferase 618 571 coexpression:428
Rv3329 aminotransferase 519 474 coexpression:454
Rv3726 dehydrogenase 486 453 coexpression:422
Rv1895 zinc-binding alcohol dehydrogenase 481 449 coexpression:417
Rv1530 adh alcohol dehydrogenase 481 449 coexpression:417
Rv2947c pks15 polyketide synthase 425 403
Rv2048c pks12 polyketide synthase 569 397
Rv2940c mas multifunctional mycocerosic acid synthase 568 396

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 8-amino-7-oxononanoate synthase
  • Pfam (hmmscan --cut_ga): Aminotran_1_2 PF00155.28 (E=2e-58), Aminotran_5 PF00266.26 (E=1e-06), DegT_DnrJ_EryC1 PF01041.24 (E=3e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177822.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aminotran_1_2 (PF00155.28), Aminotran_5 (PF00266.26), DegT_DnrJ_EryC1 (PF01041.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0156
  • Curated reference: UniProt P9WQ87 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor bioA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1569|bioF1
MKAATQARIDDSPLAWLDAVQRQRHEAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVIDGGVQALRIWGAGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGLSGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHGALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKALGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAARAALRVLQAEPWRPQAVLNHAGELARMCGVAAVPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLTARASLNAGELELARRVLTDVLAVARR