birA Resolved · high auto-curated

H37Rv Rv3279c · MTBC0 mtbc0_003487 · 266 aa · 3683355–3684155 (-) · RefSeq NP_217796.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase
MTBC0 PGAP re-annotationbiotin--[acetyl-CoA-carboxylase] ligase
Revised (this work)Biotin--[acetyl-CoA-carboxylase] ligase. Pfam: BPL_LplA_LipB (PF03099.25), BPL_C (PF02237.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YFP0 SwissProt · reviewed · Evidence at protein level
UniProt nameBiotin--[acetyl-CoA-carboxylase] ligase
EC (curated) EC 6.3.4.15
Curated functionCatalyzes the transfer of biotin onto a conserved lysine residue of the biotin carboxyl carrier protein (BCCP) domain of acetyl-CoA carboxylase and converts it to active holo-BCCP. Forms an acyl-adenylate intermediate. Cannot use GTP or desthiobiotin.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namebirA
eggNOG descriptionbiotin lipoate A B protein ligase
Orthologous groupCOG0340
EC number EC 6.3.4.15
KEGG orthology K03524
KEGG pathways map00780, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.498 · purifying
Polymorphic sites (≥ 0.1% of strains) 10 synonymous, 13 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPL_LplA_LipBPF03099.25 9.1e-0955–147 Biotin/lipoate A/B protein ligase family
BPL_CPF02237.24 4.0e-13218–264 Biotin protein ligase C terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: accD5 (propionyl-CoA carboxylase subunit beta), high confidence from genomic context alone (score 936 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3280 accD5 propionyl-CoA carboxylase subunit beta 959 936 ctx neighborhood:788 database:622
Rv3285 accA3 bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA 956 928 ctx neighborhood:406 cooccurence:685 database:644 textmining:421
Rv1589 bioB biotin synthetase 985 912 database:900 textmining:840
Rv1442 bisC biotin sulfoxide reductase BisC 904 902 database:900
Rv2501c accA1 acetyl/propionyl-CoA carboxylase subuit alpha 969 887 ctx cooccurence:670 database:644 textmining:745
Rv1722 carboxylase 954 884 database:844 textmining:626
Rv0973c accA2 acetyl/propionyl-CoA carboxylase subuit alpha 948 882 ctx cooccurence:659 database:644 textmining:578
Rv3278c transmembrane protein 822 823 ctx neighborhood:822
Rv2967c pca pyruvate carboxylase 822 799 database:662
Rv3282 hyp hypothetical protein 774 775 ctx neighborhood:766
Rv3281 accE5 bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE 864 767 ctx neighborhood:766 textmining:441
Rv3799c accD4 propionyl-CoA carboxylase subunit beta AccD 812 749 database:622
Rv2247 accD6 acetyl-/propionyl-CoA carboxylase subunit beta 766 720 database:622
Rv2524c fas fatty acid synthase 836 717 ctx neighborhood:544 coexpression:404 textmining:448
Rv3221c TB7.3 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 961 696 database:662 textmining:878

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase
  • MTBC0 PGAP product: biotin--[acetyl-CoA-carboxylase] ligase
  • Pfam (hmmscan --cut_ga): BPL_LplA_LipB PF03099.25 (E=9e-09), BPL_C PF02237.24 (E=4e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217796.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPL_LplA_LipB (PF03099.25), BPL_C (PF02237.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0340
  • Curated reference: UniProt I6YFP0 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor accD5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003487|Rv3279c|birA
MTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR