pepB Resolved · high auto-curated

H37Rv Rv2213 · MTBC0 mtbc0_002349 · 515 aa · 2504495–2506042 (+) · RefSeq NP_216729.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cytosol aminopeptidase
MTBC0 PGAP re-annotationleucyl aminopeptidase
Revised (this work)Leucyl aminopeptidase. Pfam: Peptidase_M17_N (PF02789.24), Peptidase_M17 (PF00883.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHT3 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable cytosol aminopeptidase
EC (curated) EC 3.4.11.1, EC 3.4.11.10
Curated functionPresumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namepepA
eggNOG descriptionPresumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides
Orthologous groupCOG0260
EC number EC 3.4.11.1
KEGG orthology K01255
KEGG pathways map00480, map01100
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.583 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_M17_NPF02789.24 2.3e-2145–157 Cytosol aminopeptidase family, N-terminal domain
Peptidase_M17PF00883.27 1.4e-114193–504 Cytosol aminopeptidase family, catalytic domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2212 (adenylyl cyclase), high confidence from genomic context alone (score 874 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2467 pepN aminopeptidase PepN 941 924 database:900
Rv0773c ggtA bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase 928 919 database:900
Rv2394 ggtB gamma-glutamyltranspeptidase precursor GgtB 912 901 database:900
Rv3704c gshA glutamate--cysteine ligase 900 901 database:900
Rv0433 carboxylate-amine ligase 900 901 database:900
Rv2212 adenylyl cyclase 880 874 ctx neighborhood:872
Rv2211c gcvT aminomethyltransferase 861 856 ctx neighborhood:785
Rv2334 cysK1 O-acetylserine sulfhydrylase 837 828 database:800
Rv3684 lyase 835 826 database:800
Rv2294 cystathionine beta-lyase 816 817 database:800
Rv1093 glyA1 serine hydroxymethyltransferase 831 815 database:800
Rv0075 aminotransferase 811 812 database:800
Rv0070c glyA2 serine hydroxymethyltransferase 826 811 database:800
Rv0761c adhB alcohol dehydrogenase B 796 784 coexpression:756
Rv2299c htpG chaperone protein HtpG 733 734 coexpression:732

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cytosol aminopeptidase
  • MTBC0 PGAP product: leucyl aminopeptidase
  • Pfam (hmmscan --cut_ga): Peptidase_M17_N PF02789.24 (E=2e-21), Peptidase_M17 PF00883.27 (E=1e-114)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216729.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_M17_N (PF02789.24), Peptidase_M17 (PF00883.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0260
  • Curated reference: UniProt P9WHT3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor Rv2212
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002349|Rv2213|pepB
MTTEPGYLSPSVAVATSMPKRGVGAAVLIVPVVSTGEEDRPGAVVASAEPFLRADTVAEIEAGLRALDATGASDQVHRLAVPSLPVGSVLTVGLGKPRREWPADTIRCAAGVAARALNSSEAVITTLAELPGDGICSATVEGLILGSYRFSAFRSDKTAPKDAGLRKITVLCCAKDAKKRALHGAAVATAVATARDLVNTPPSHLFPAEFAKRAKTLSESVGLDVEVIDEKALKKAGYGGVIGVGQGSSRPPRLVRLIHRGSRLAKNPQKAKKVALVGKGITFDTGGISIKPAASMHHMTSDMGGAAAVIATVTLAARLRLPIDVIATVPMAENMPSATAQRPGDVLTQYGGTTVEVLNTDAEGRLILADAIVRACEDKPDYLIETSTLTGAQTVALGTRIPGVMGSDEFRDRVAAISQRVGENGWPMPLPDDLKDDLKSTVADLANVSGQRFAGMLVAGVFLREFVAESVDWAHIDVAGPAYNTGSAWGYTPKGATGVPTRTMFAVLEDIAKNG