pepB Resolved · high auto-curated
H37Rv Rv2213 · MTBC0 mtbc0_002349 ·
515 aa ·
2504495–2506042 MTBC0
(+) ·
RefSeq NP_216729.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cytosol aminopeptidase |
|---|---|
| MTBC0 PGAP re-annotation | leucyl aminopeptidase |
| Revised (this work) | Leucyl aminopeptidase. Pfam: Peptidase_M17_N (PF02789.24), Peptidase_M17 (PF00883.27). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (3 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| An N-acetyltransferase required for EsxA N-terminal protein acetylation and virulence in Mycobacterium marinum. doi:10.1101/2023.03.14.532585 | 2023 |
| High rate of reinfection and possible transmission of Mycobacterium avium complex in Northeast Thailand. doi:10.1016/j.onehlt.2022.100374 | 2022 |
| Identification of novel scaffolds targeting Mycobacterium tuberculosis. doi:10.1007/s00109-019-01840-7 | 2019 |
| Activity of human beta defensin-1 and its motif against active and dormant Mycobacterium tuberculosis. doi:10.1007/s00253-017-8466-3 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.28 (95% CI -0.15 to 3.92). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Protein degradation |
|---|---|
| Mycobrowser EC |
3.4.11.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2236
· 99.6% identity |
|---|---|
| M. leprae |
ML0864c
· 83.1% identity |
| M. marinum |
MMAR_3258
· 85.0% identity |
| M. smegmatis |
MSMEG_4281
· 72.6% identity |
| M. orygis |
RJtmp_002284
· 99.6% identity |
| M. abscessus |
MAB_1948c
· 68.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHT3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable cytosol aminopeptidase |
| EC (curated) |
EC 3.4.11.1, EC 3.4.11.10
|
| Curated function | Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | pepA |
| eggNOG description | Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides |
| Orthologous group | COG0260 |
| EC number |
EC 3.4.11.1
|
| KEGG orthology |
K01255
|
| KEGG pathways |
map00480, map01100
|
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.583 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 83.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 52.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 0.938, mean read count 103.733333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 510.0 ppm · rank 394/3519 (88.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 515 aa |
|---|---|
| Molecular weight | 53.5 kDa |
| Theoretical pI | 8.18 |
| GRAVY | 0.073 (hydrophobic) |
| Aliphatic index | 93.3 |
| Aromaticity | 0.043 |
| Instability index | 28.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Peptidase_M17_N | PF02789.24 | 2.3e-21 | 45–157 | Cytosol aminopeptidase family, N-terminal domain |
Peptidase_M17 | PF00883.27 | 1.4e-114 | 193–504 | Cytosol aminopeptidase family, catalytic domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8pz0-assembly1_A |
1.00 | 0.86 | 5.1e-51 sig | 8pz0-assembly1_A Intracellular leucine aminopeptidase of Pseudomonas aeruginosa PA14. |
3h8g-assembly1_D |
1.00 | 0.86 | 4.7e-50 sig | 3h8g-assembly1_D Bestatin complex structure of leucine aminopeptidase from Pseudomonas putida |
5lhj-assembly1_A |
1.00 | 0.93 | 5.2e-47 sig | 5lhj-assembly1_A Bottromycin maturation enzyme BotP |
4zla-assembly1_A |
1.00 | 0.89 | 1.5e-46 sig | 4zla-assembly1_A Bestatin complex structure of leucine aminopeptidase from Helicobacter pylori |
4zla-assembly1_D |
1.00 | 0.90 | 1.1e-45 sig | 4zla-assembly1_D Bestatin complex structure of leucine aminopeptidase from Helicobacter pylori |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2212 (+ strand, 11 bp gap) |
|---|---|
| Downstream (3' on genome) | ephD (- strand, 37 bp gap) |
| Predicted operon |
Rv2212 · pepB
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2212 (adenylyl cyclase), high confidence from genomic context alone (score 874 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2467 pepN exp |
aminopeptidase PepN | 941 | 924 | database:900 |
Rv0773c ggtA exp |
bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase | 928 | 919 | database:900 |
Rv2394 ggtB exp |
gamma-glutamyltranspeptidase precursor GgtB | 912 | 901 | database:900 |
Rv3704c gshA exp |
glutamate--cysteine ligase | 900 | 901 | database:900 |
Rv0433 exp |
carboxylate-amine ligase | 900 | 901 | database:900 |
Rv2212 |
adenylyl cyclase | 880 | 874 ctx | neighborhood:872 |
Rv2211c gcvT |
aminomethyltransferase | 861 | 856 ctx | neighborhood:785 |
Rv2334 cysK1 exp |
O-acetylserine sulfhydrylase | 837 | 828 | database:800 |
Rv3684 exp |
lyase | 835 | 826 | database:800 |
Rv2294 exp |
cystathionine beta-lyase | 816 | 817 | database:800 |
Rv1093 glyA1 exp |
serine hydroxymethyltransferase | 831 | 815 | database:800 |
Rv0075 exp |
aminotransferase | 811 | 812 | database:800 |
Rv0070c glyA2 exp |
serine hydroxymethyltransferase | 826 | 811 | database:800 |
Rv0761c adhB |
alcohol dehydrogenase B | 796 | 784 | coexpression:756 |
Rv2299c htpG |
chaperone protein HtpG | 733 | 734 | coexpression:732 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cytosol aminopeptidase
- MTBC0 PGAP product: leucyl aminopeptidase
- Pfam (hmmscan --cut_ga): Peptidase_M17_N PF02789.24 (E=2e-21), Peptidase_M17 PF00883.27 (E=1e-114)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216729.1)
- Domains: Pfam-A via hmmscan --cut_ga — Peptidase_M17_N (PF02789.24), Peptidase_M17 (PF00883.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0260 - Curated reference: UniProt P9WHT3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
Rv2212 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002349|Rv2213|pepB MTTEPGYLSPSVAVATSMPKRGVGAAVLIVPVVSTGEEDRPGAVVASAEPFLRADTVAEIEAGLRALDATGASDQVHRLAVPSLPVGSVLTVGLGKPRREWPADTIRCAAGVAARALNSSEAVITTLAELPGDGICSATVEGLILGSYRFSAFRSDKTAPKDAGLRKITVLCCAKDAKKRALHGAAVATAVATARDLVNTPPSHLFPAEFAKRAKTLSESVGLDVEVIDEKALKKAGYGGVIGVGQGSSRPPRLVRLIHRGSRLAKNPQKAKKVALVGKGITFDTGGISIKPAASMHHMTSDMGGAAAVIATVTLAARLRLPIDVIATVPMAENMPSATAQRPGDVLTQYGGTTVEVLNTDAEGRLILADAIVRACEDKPDYLIETSTLTGAQTVALGTRIPGVMGSDEFRDRVAAISQRVGENGWPMPLPDDLKDDLKSTVADLANVSGQRFAGMLVAGVFLREFVAESVDWAHIDVAGPAYNTGSAWGYTPKGATGVPTRTMFAVLEDIAKNG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pepB? Email the maintainer — the message is pre-filled with this gene's details.