Rv1571 Family assigned · medium auto-curated

H37Rv Rv1571 · MTBC0 mtbc0_001679 · 169 aa · 1790503–1791012 (+) · RefSeq NP_216087.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation2'-5' RNA ligase family protein
Revised (this work)2'-5' RNA ligase family protein. Pfam: 2_5_RNA_ligase2 (PF13563.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06619 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
eggNOG description2'-5' RNA ligase superfamily
Orthologous groupCOG1514

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.52 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
2_5_RNA_ligase2PF13563.13 2.8e-1012–134 2'-5' RNA ligase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bioD (ATP-dependent dethiobiotin synthetase BioD), high confidence from genomic context alone (score 953 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1570 bioD ATP-dependent dethiobiotin synthetase BioD 990 953 ctx neighborhood:882 coexpression:615 textmining:806
Rv1569 bioF1 8-amino-7-oxononanoate synthase 985 895 ctx neighborhood:882 textmining:870
Rv1568 bioA adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA 975 882 ctx neighborhood:881 textmining:803
Rv1567c membrane protein 741 741 ctx neighborhood:741
Rv1563c treY maltooligosyl trehalose synthase 686 686 ctx neighborhood:623
Rv3300c hyp hypothetical protein 463 464
Rv0519c membrane protein 498 459 coexpression:414
Rv1776c transcriptional regulator 453 454 ctx cooccurence:453
Rv1972 Mce associated membrane protein 441 442 ctx cooccurence:436
Rv1125 hyp hypothetical protein 428 428 ctx cooccurence:409
Rv1140 integral membrane protein 427 428
Rv1026 ppx2 hyp hypothetical protein 422 423 coexpression:423
Rv3584 lpqE lipoprotein LpqE 419 419
Rv1274 lprB lipoprotein LprB 412 412 ctx cooccurence:412
Rv1901 cinA competence damage-inducible protein CinA 672 392 textmining:484

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: 2'-5' RNA ligase family protein
  • Pfam (hmmscan --cut_ga): 2_5_RNA_ligase2 PF13563.13 (E=3e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216087.1)
  • Domains: Pfam-A via hmmscan --cut_ga — 2_5_RNA_ligase2 (PF13563.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1514
  • Curated reference: UniProt O06619 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor bioD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001679|Rv1571|
MVHSIELVFDSDTEAAIRRIWAGLAAAGIPSQAPASRPHVSLAVAERIAPEVDEPLGAVARRLPLDCVIGAPVLFGRANVVFTRLVVPTSELLALHAEVHRLCGPHLAPAPMANSLPGQWTAHVTLARRVGGHQLGRALRIAGRPSRIDGRFAGLRRWDGNTRAEYLLG