Rv1588c Still unknown · low auto-curated

H37Rv Rv1588c · MTBC0 - · 222 aa · 1789168–1789836 (-) · RefSeq NP_216104.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF222. Function unknown. Foldseek best (non-significant) hit: 2qww-assembly3_F Crystal structure of multiple antibiotic-resistance r (prob 0.18, TM 0.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLT9 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized protein Rv1588c

UniProt still lists this protein as Uncharacterized protein Rv1588c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionDomain of unknown function (DUF222)
Orthologous groupCOG1403
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.323 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF222PF02720.23 6.4e-2238–138 Domain of unknown function (DUF222)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.1 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2qww-assembly3_F 0.18 0.26 3.3e-01 2qww-assembly3_F Crystal structure of multiple antibiotic-resistance repressor (MarR) (YP_013417.1) from Listeria monocytogenes 4b F2365 at 2.07 A resolution
2bke-assembly1_A 0.15 0.54 5.3e+00 2bke-assembly1_A Conformational Flexibility Revealed by the Crystal Structure of a Crenarchaeal RadA
1lnw-assembly2_C 0.03 0.21 4.4e+00 1lnw-assembly2_C CRYSTAL STRUCTURE OF THE MEXR REPRESSOR OF THE MEXAB-OPRM MULTIDRUG EFFLUX OPERON OF PSEUDOMONAS AERUGINOSA

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1586c (phage integrase), high confidence from genomic context alone (score 786 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1587c hyp hypothetical protein 787 787 ctx neighborhood:773
Rv1586c phage integrase 786 786 ctx neighborhood:780
Rv1585c phage protein 778 778 ctx neighborhood:773
Rv3466 hyp hypothetical protein 762 761 coexpression:761
Rv1582c phage protein 622 619 ctx neighborhood:617
Rv1583c phage protein 609 609 ctx neighborhood:605
Rv1584c phage protein 608 607 ctx neighborhood:605
Rv1578c phage protein 549 549
Rv1148c hyp hypothetical protein 444 359
Rv3776 hyp hypothetical protein 453 339
Rv0336 hyp hypothetical protein 844 233 textmining:806
Rv2100 hyp hypothetical protein 837 203 textmining:804
Rv0515 hyp hypothetical protein 701 161 textmining:659
Rv2719c chiZ membrane protein 540 101 textmining:510
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 535 67 textmining:523

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF222 PF02720.23 (E=6e-22)
  • Foldseek best: 2qww-assembly3_F Crystal structure of multiple antibiotic-resistance repressor ( (prob 0.18, E=3e-01, TM=0.26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216104.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF222 (PF02720.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1403
  • Curated reference: UniProt P9WLT9 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.1, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv1586c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1588c|
MLANSREELVEVFDALDAELDRLDEVSFEVLTTPERLRSLERLECLVRRLPAVGHALINQLDAQASEEELGGTLCCALANRLRITKPDAARRIADAADLGPRRALTGEPLAPQLTATATAQRQGLIGEAHVKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRRRPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL