mftR Family assigned · medium auto-curated
H37Rv Rv0691c · MTBC0 mtbc0_000731 ·
198 aa · 795156–795752 (-) ·
RefSeq NP_215205.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | mycofactocin biosynthesis transcriptional regulator MftR |
|---|---|
| MTBC0 PGAP re-annotation | mycofactocin system transcriptional regulator |
| Revised (this work) | Mycofactocin system transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_14 (PF17754.7). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WMB7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative mycofactocin biosynthesis transcriptional regulator MftR |
| Curated function | May regulate a gene cluster involved in mycofactocin expression. Mycofactocin is a conserved polypeptide that might serve as an electron carrier. |
UniProt still lists this protein as Putative mycofactocin biosynthesis transcriptional regulator MftR; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | mftR |
| eggNOG description | Transcriptional regulator |
| Orthologous group | COG1309 |
| Gene Ontology (41) |
GO:0000976, GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737 +29 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.218 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TetR_N | PF00440.30 | 2.4e-13 | 19–60 | Bacterial regulatory proteins, tetR family |
TetR_C_14 | PF17754.7 | 5.8e-41 | 85–193 | MftR C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3830c (TetR family transcriptional regulator), high confidence from genomic context alone (score 908 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3830c |
TetR family transcriptional regulator | 908 | 908 ctx | cooccurence:420 coexpression:848 |
Rv0692 mftB |
mycofactocin system protein MftB | 980 | 902 ctx | neighborhood:603 cooccurence:762 textmining:812 |
Rv0693 mftC |
mycofactocin radical SAM maturase MftC | 961 | 893 ctx | neighborhood:602 cooccurence:741 textmining:658 |
Rv3183 higA3 |
transcriptional regulator | 882 | 882 | coexpression:850 |
Rv0690c hyp |
hypothetical protein | 882 | 882 ctx | neighborhood:882 |
Rv3167c |
TetR family transcriptional regulator | 882 | 879 | coexpression:857 |
Rv0212c nadR |
transcriptional regulator NadR | 869 | 863 | coexpression:863 |
Rv1151c cobB |
NAD-dependent protein deacylase | 866 | 861 | coexpression:861 |
Rv1267c embR |
transcriptional regulator EmbR | 863 | 860 | coexpression:860 |
Rv3736 |
AraC/XylS family transcriptional regulator | 862 | 860 | coexpression:860 |
Rv3263 |
DNA methylase | 860 | 860 | coexpression:860 |
Rv1675c cmr |
HTH-type transcriptional regulator Cmr | 860 | 860 | coexpression:860 |
Rv3840 |
transcriptional regulator | 860 | 860 | coexpression:860 |
Rv1359 |
transcriptional regulator | 860 | 860 | coexpression:860 |
Rv1674c |
transcriptional regulator | 863 | 858 | coexpression:858 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: mycofactocin biosynthesis transcriptional regulator MftR
- MTBC0 PGAP product: mycofactocin system transcriptional regulator
- Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=2e-13), TetR_C_14 PF17754.7 (E=6e-41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215205.1)
- Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_14 (PF17754.7)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1309 - Curated reference: UniProt P9WMB7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
93 functional partner(s); context anchor
Rv3830c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000731|Rv0691c|mftR MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAIPWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPELQAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTEALGAAFDVVGAGLDRLNQ