mftB Resolved · high auto-curated
H37Rv Rv0692 · MTBC0 mtbc0_000733 ·
109 aa · 795917–796246 (+) ·
RefSeq NP_215206.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | mycofactocin system protein MftB |
|---|---|
| MTBC0 PGAP re-annotation | mycofactocin biosynthesis chaperone MftB |
| Revised (this work) | Mycofactocin biosynthesis chaperone MftB. Pfam: MftB_chaperone (PF26520.1). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P95038
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Peptide chaperone MftB |
| Curated function | Peptide chaperone involved in the biosynthesis of the enzyme cofactor mycofactocin (MFT). Binds MftA and MftC with high affinity, and is essential for MftC activity on MftA, likely via the formation of a ternary complex. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Mycofactocin system |
| Orthologous group | COG0535 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MftB_chaperone | PF26520.1 | 8.6e-34 | 27–103 | Peptide chaperone MftB family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mftC (mycofactocin radical SAM maturase MftC), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0693 mftC |
mycofactocin radical SAM maturase MftC | 999 | 1000 ctx | neighborhood:882 cooccurence:774 coexpression:845 database:900 textmining:907 |
Rv0694 mftD |
mycofactocin system heme/flavin oxidoreductase MftD | 999 | 990 ctx | neighborhood:882 cooccurence:699 coexpression:734 textmining:907 |
Rv0695 mftE |
mycofactocin system creatinine amidohydrolase family protein MftE | 998 | 967 ctx | neighborhood:738 cooccurence:757 database:500 textmining:943 |
Rv0696 mftF |
mycofactocin biosynthesis glycosyltransferase MftF | 994 | 931 ctx | neighborhood:702 cooccurence:769 textmining:929 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 980 | 902 ctx | neighborhood:603 cooccurence:762 textmining:812 |
Rv0691A mftA |
mycofactocin precursor | 984 | 882 ctx | neighborhood:882 textmining:870 |
Rv1990A |
Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g | 758 | 750 ctx | cooccurence:748 |
Rv0697 mftG |
dehydrogenase | 716 | 705 ctx | neighborhood:702 |
Rv0690c hyp |
hypothetical protein | 608 | 607 ctx | neighborhood:595 |
Rv3169 hyp |
hypothetical protein | 521 | 522 ctx | cooccurence:520 |
Rv2425c hyp |
hypothetical protein | 499 | 500 ctx | cooccurence:464 |
Rv2750 |
dehydrogenase | 815 | 496 ctx | cooccurence:496 textmining:648 |
Rv0687 |
NAD-dependent oxidoreductase | 792 | 439 ctx | cooccurence:437 textmining:645 |
Rv1681 moeX |
molybdopterin biosynthesis protein MoeX | 408 | 321 | |
Rv0761c adhB |
alcohol dehydrogenase B | 857 | 271 | textmining:812 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: mycofactocin system protein MftB
- MTBC0 PGAP product: mycofactocin biosynthesis chaperone MftB
- Pfam (hmmscan --cut_ga): MftB_chaperone PF26520.1 (E=9e-34)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215206.1)
- Domains: Pfam-A via hmmscan --cut_ga — MftB_chaperone (PF26520.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0535 - Curated reference: UniProt P95038 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
mftC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000733|Rv0692|mftB MWGLLTVPAPAQARRADSSEFDPDRGWRLHPQVAVRPEPFGALLYHFGTRKLSFLKNRTILAVVQTLADYPDIRSACRGAGVDDCDQDPYLHALSVLAGSNMLVPRQTT