rpmI Resolved · high auto-curated
H37Rv Rv1642 · MTBC0 - ·
64 aa ·
1852928–1853122 H37Rv
(+) ·
RefSeq NP_216158.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 50S ribosomal protein L35 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | 50S ribosomal protein L35. Pfam: Ribosomal_L35p (PF01632.25). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 60 publications
60 TB publications mention this gene. 60 publication(s) discuss this gene (51 in a M. tuberculosis context, 7 in other mycobacteria — M. leprae (5), M. abscessus (2), M. marinum (2)).
| Publication | Date |
|---|---|
| Comparison of four culture protocols for differentiating bovine peripheral blood mononuclear cells into macrophages. doi:10.3389/fvets.2026.1851348 | 2026 |
| Macrophage profiles in drug-resistant tuberculosis patients and their close contacts: A pilot study. doi:10.1016/j.ijtb.2025.07.004 | 2025 |
| Targeted Nasal Route Delivery of Cationic Anti-TB Drug-Loaded Nano-embedded Microparticles for Mycobacterial Elimination in the CNS. doi:10.1021/acs.molpharmaceut.5c00106 | 2025 |
| Pharmacokinetic and Pharmacodynamics of Clofazimine Nano-in-Microparticles: Enhanced Brain Delivery and CNS Tuberculosis Amelioration via Intranasal Administration. doi:10.1021/acsinfecdis.4c00767 | 2025 |
| Trans-nasal brain delivery of anti-TB drugs by methyl-β-cyclodextrin microparticles show efficient mycobacterial clearance from central nervous system. doi:10.1016/j.jconrel.2024.12.031 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 83% of residues (metapredict) · mean AlphaFold pLDDT 92.7 |
|---|---|
| Disordered regions | 1 IDR(s), longest 64 aa [0-64] |
sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -12.44 (95% CI -15.80 to -9.30). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Translation |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1669
· 100.0% identity |
|---|---|
| M. leprae |
ML1395
· 90.6% identity |
| M. marinum |
MMAR_2449
· 93.8% identity |
| M. smegmatis |
MSMEG_3792
· 84.4% identity |
| M. orygis |
RJtmp_001717
· 100.0% identity |
| M. abscessus |
MAB_2322
· 82.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WH91
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Large ribosomal subunit protein bL35 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpmI |
| eggNOG description | Belongs to the bacterial ribosomal protein bL35 family |
| Orthologous group | COG0291 |
| KEGG orthology |
K02916
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (25) |
GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0015934, GO:0022625, GO:0022626 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.36 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 90.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | Uncertain · uncertain |
|---|---|
| What the call means | uncertain (short or TA-poor ORF): no call possible |
| TA sites (Himar1) | 1 in the ORF — 0 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 1 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 408.0 ppm · rank 494/3519 (86.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 64 aa |
|---|---|
| Molecular weight | 7.2 kDa |
| Theoretical pI | 12.0 |
| GRAVY | -1.108 (hydrophilic) |
| Aliphatic index | 62.5 |
| Aromaticity | 0.016 |
| Instability index | 48.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_L35p | PF01632.25 | 2.3e-24 | 2–62 | Ribosomal protein L35 |
Experimental structures (Protein Data Bank) 11 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7sfr |
Electron Microscopy | 2.6 Å | 100% |
7kgb |
Electron Microscopy | 2.7 Å | 100% |
7mt7 |
Electron Microscopy | 2.71 Å | 100% |
7mt2 |
Electron Microscopy | 2.76 Å | 100% |
7msm |
Electron Microscopy | 2.79 Å | 100% |
7mt3 |
Electron Microscopy | 2.8 Å | 100% |
7msc |
Electron Microscopy | 2.97 Å | 100% |
7msz |
Electron Microscopy | 3.1 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (11 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7mt7-assembly1_3 |
1.00 | 0.98 | 1.4e-10 sig | 7mt7-assembly1_3 Mtb 70S with P and E site tRNAs |
7msh-assembly1_3 |
1.00 | 0.98 | 2.2e-10 sig | 7msh-assembly1_3 Mtb 70SIC in complex with MtbEttA at Pre_R1 state |
8v9j-assembly1_7 |
1.00 | 0.98 | 5.0e-10 sig | 8v9j-assembly1_7 Cryo-EM structure of the Mycobacterium smegmatis 70S ribosome in complex with hibernation factor Msmeg1130 (Balon) (Structure 4) |
8xz3-assembly1_e |
1.00 | 0.98 | 1.3e-09 sig | 8xz3-assembly1_e Mycobacterium smegmatis 50S ribosomal subunit with Erythromycin |
6dzp-assembly1_e |
1.00 | 0.97 | 1.2e-09 sig | 6dzp-assembly1_e Cryo-EM Structure of Mycobacterium smegmatis C(minus) 50S ribosomal subunit |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | infC (+ strand, 49 bp gap) |
|---|---|
| Downstream (3' on genome) | rplT (+ strand, 61 bp gap) |
| Predicted operon |
infC · rpmI
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1015c rplY exp |
50S ribosomal protein L25/general stress protein Ctc | 999 | 1000 | coexpression:702 experimental:999 |
Rv0634B rpmG2 exp |
50S ribosomal protein L33 | 999 | 1000 | coexpression:672 experimental:999 |
Rv0720 rplR exp |
50S ribosomal protein L18 | 999 | 1000 | coexpression:855 experimental:999 textmining:699 |
Rv2441c rpmA exp |
50S ribosomal protein L27 | 999 | 1000 | coexpression:811 experimental:999 |
Rv1298 rpmE exp |
50S ribosomal protein L31 | 999 | 1000 | coexpression:791 experimental:999 textmining:457 |
Rv3443c rplM exp |
50S ribosomal protein L13 | 999 | 1000 | coexpression:865 experimental:999 |
Rv0719 rplF exp |
50S ribosomal protein L6 | 999 | 1000 | coexpression:872 experimental:999 textmining:456 |
Rv0702 rplD exp |
50S ribosomal protein L4 | 999 | 1000 | coexpression:902 experimental:999 |
Rv3456c rplQ exp |
50S ribosomal protein L17 | 999 | 1000 | coexpression:839 experimental:999 textmining:560 |
Rv0707 rpsC exp |
30S ribosomal protein S3 | 999 | 1000 | coexpression:854 experimental:999 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 999 | 1000 | coexpression:861 experimental:999 |
Rv0056 rplI exp |
50S ribosomal protein L9 | 999 | 1000 | coexpression:651 experimental:999 |
Rv0722 rpmD exp |
50S ribosomal protein L30 | 999 | 1000 | coexpression:857 experimental:999 textmining:542 |
Rv0723 rplO exp |
50S ribosomal protein L15 | 999 | 1000 | coexpression:844 experimental:999 |
Rv3459c rpsK exp |
30S ribosomal protein S11 | 999 | 1000 | coexpression:863 experimental:999 textmining:457 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L35
- Pfam (hmmscan --cut_ga): Ribosomal_L35p PF01632.25 (E=2e-24)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216158.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L35p (PF01632.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0291 - Curated reference: UniProt P9WH91 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 163 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1642|rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVAANDTKRVTSLLNG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rpmI? Email the maintainer — the message is pre-filled with this gene's details.