rpmI Resolved · high auto-curated

H37Rv Rv1642 · MTBC0 - · 64 aa · 1852928–1853122 (+) · RefSeq NP_216158.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L35
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L35. Pfam: Ribosomal_L35p (PF01632.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH91 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL35

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmI
eggNOG descriptionBelongs to the bacterial ribosomal protein bL35 family
Orthologous groupCOG0291
KEGG orthology K02916
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (25) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0015934, GO:0022625, GO:0022626 +13 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.36 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L35pPF01632.25 2.3e-242–62 Ribosomal protein L35

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:702 experimental:999
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:672 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:855 experimental:999 textmining:699
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:811 experimental:999
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:791 experimental:999 textmining:457
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:865 experimental:999
Rv0719 rplF 50S ribosomal protein L6 999 1000 coexpression:872 experimental:999 textmining:456
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:902 experimental:999
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:839 experimental:999 textmining:560
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:854 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:861 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:651 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:857 experimental:999 textmining:542
Rv0723 rplO 50S ribosomal protein L15 999 1000 coexpression:844 experimental:999
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:863 experimental:999 textmining:457

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L35
  • Pfam (hmmscan --cut_ga): Ribosomal_L35p PF01632.25 (E=2e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216158.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L35p (PF01632.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0291
  • Curated reference: UniProt P9WH91 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 163 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1642|rpmI
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVAANDTKRVTSLLNG