rpsR1 Resolved · high auto-curated

H37Rv Rv0055 · MTBC0 - · 84 aa · 59122–59376 (+) · RefSeq YP_177688.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S18
MTBC0 PGAP re-annotation
Revised (this work)30S ribosomal protein S18. Pfam: Ribosomal_S18 (PF01084.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH49 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein bS18A
Curated functionBinds as a heterodimer with protein bS6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsR
eggNOG descriptionBinds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit
Orthologous groupCOG0238
KEGG orthology K02963
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (51) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0006412, GO:0006518, GO:0006807 +39 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.326 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S18PF01084.27 4.8e-2328–77 Ribosomal protein S18

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0714 rplN 50S ribosomal protein L14 999 1000 coexpression:729 experimental:999 textmining:578
Rv3460c rpsM 30S ribosomal protein S13 999 1000 coexpression:668 experimental:999
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:732 experimental:999
Rv0701 rplC 50S ribosomal protein L3 999 1000 coexpression:733 experimental:999
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:733 experimental:999
Rv2412 rpsT 30S ribosomal protein S20 999 1000 coexpression:711 experimental:999 textmining:666
Rv0715 rplX 50S ribosomal protein L24 999 1000 coexpression:723 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 coexpression:726 experimental:999 database:540
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:685 experimental:999
Rv2785c rpsO 30S ribosomal protein S15 999 1000 coexpression:731 experimental:999 database:540
Rv0716 rplE 50S ribosomal protein L5 999 1000 coexpression:733 experimental:999
Rv0721 rpsE 30S ribosomal protein S5 999 1000 coexpression:732 experimental:999 database:540
Rv0709 rpmC 50S ribosomal protein L29 999 1000 coexpression:731 experimental:999
Rv0718 rpsH 30S ribosomal protein S8 999 1000 coexpression:734 experimental:999 database:540
Rv0704 rplB 50S ribosomal protein L2 999 1000 coexpression:734 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 30S ribosomal protein S18
  • Pfam (hmmscan --cut_ga): Ribosomal_S18 PF01084.27 (E=5e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177688.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S18 (PF01084.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0238
  • Curated reference: UniProt P9WH49 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 141 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0055|rpsR1
MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR