rplN Resolved · high auto-curated

H37Rv Rv0714 · MTBC0 - · 122 aa · 811373–811741 (+) · RefSeq NP_215228.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L14
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L14. Pfam: Ribosomal_L14 (PF00238.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHD9 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL14
Curated functionBinds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplN
eggNOG descriptionBinds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome
Orthologous groupCOG0093
KEGG orthology K02874
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (37) GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840 +25 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L14PF00238.25 1.2e-551–122 Ribosomal protein L14p/L23e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplF (50S ribosomal protein L6), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:875 experimental:999
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:958 experimental:999 database:571 textmining:687
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx neighborhood:727 cooccurence:685 coexpression:957 experimental:999 database:571 textmining:715
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:866 experimental:999 database:638 textmining:682
Rv0722 rpmD 50S ribosomal protein L30 999 1000 ctx neighborhood:714 coexpression:864 experimental:999 database:628 textmining:485
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:775 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:943 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 ctx cooccurence:687 coexpression:865 experimental:999 textmining:608
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:529 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:766 experimental:999
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:839 experimental:999 textmining:594
Rv0720 rplR 50S ribosomal protein L18 999 1000 ctx neighborhood:727 coexpression:883 experimental:999 database:638 textmining:428
Rv3442c rpsI 30S ribosomal protein S9 999 1000 ctx cooccurence:495 coexpression:948 experimental:999 textmining:590
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:856 experimental:999 textmining:593
Rv0682 rpsL 30S ribosomal protein S12 999 1000 ctx cooccurence:641 coexpression:907 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L14
  • Pfam (hmmscan --cut_ga): Ribosomal_L14 PF00238.25 (E=1e-55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215228.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L14 (PF00238.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0093
  • Curated reference: UniProt P9WHD9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 314 functional partner(s); context anchor rplF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0714|rplN
MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREKRFMKIISLAPEVL