rpsG Resolved · high auto-curated

H37Rv Rv0683 · MTBC0 - · 156 aa · 781934–782404 (+) · RefSeq NP_215197.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S7
MTBC0 PGAP re-annotation
Revised (this work)30S ribosomal protein S7. Pfam: Ribosomal_S7 (PF00177.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH29 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS7
Curated functionOne of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsG
eggNOG descriptionOne of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA
Orthologous groupCOG0049
KEGG orthology K02992
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (80) GO:0000028, GO:0003674, GO:0003676, GO:0003723, GO:0003729, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623 +68 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.026 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S7PF00177.28 4.1e-632–149 Ribosomal protein S7p/S5e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsC (30S ribosomal protein S3), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:865 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:837 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:888 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 ctx cooccurence:482 coexpression:864 experimental:999 database:925
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:864 experimental:999
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:908 experimental:999 database:844
Rv0719 rplF 50S ribosomal protein L6 999 1000 coexpression:889 experimental:999
Rv3443c rplM 50S ribosomal protein L13 999 1000 ctx cooccurence:453 coexpression:875 experimental:999
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:724 experimental:999
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:905 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:864 experimental:999
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:699 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:787 experimental:999
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:830 experimental:999 textmining:850
Rv0682 rpsL 30S ribosomal protein S12 999 1000 ctx neighborhood:882 cooccurence:766 coexpression:993 experimental:999 database:844 textmining:794

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 30S ribosomal protein S7
  • Pfam (hmmscan --cut_ga): Ribosomal_S7 PF00177.28 (E=4e-63)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215197.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S7 (PF00177.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0049
  • Curated reference: UniProt P9WH29 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 261 functional partner(s); context anchor rpsC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0683|rpsG
MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW