deoC Resolved · high auto-curated

H37Rv Rv0478 · MTBC0 mtbc0_000503 · 224 aa · 570587–571261 (+) · RefSeq NP_214992.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)2-deoxyribose-5-phosphate aldolase
MTBC0 PGAP re-annotationdeoxyribose-phosphate aldolase
Revised (this work)Deoxyribose-phosphate aldolase. Pfam: DeoC (PF01791.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP03 SwissProt · reviewed · Evidence at protein level
UniProt nameDeoxyribose-phosphate aldolase
EC (curated) EC 4.1.2.4
Curated functionCatalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namedeoC
eggNOG descriptionCatalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy- D-ribose 5-phosphate
Orthologous groupCOG0274
EC number EC 4.1.2.4
KEGG orthology K01619
KEGG pathways map00030
Gene Ontology (52) GO:0003674, GO:0003824, GO:0004139, GO:0005975, GO:0006139, GO:0006725, GO:0006753, GO:0006793, GO:0006796, GO:0006807, GO:0008150, GO:0008152 +40 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.193 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DeoCPF01791.16 8.1e-1812–218 DeoC/LacD family aldolase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rbsK (ribokinase RbsK), high confidence from genomic context alone (score 950 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2436 rbsK ribokinase RbsK 955 950 ctx fusion:493 database:900
Rv3314c deoA thymidine phosphorylase 955 942 ctx cooccurence:714 coexpression:728
Rv1449c tkt transketolase 938 920 database:900
Rv1448c tal transaldolase 917 906 database:900
Rv0363c fba fructose-bisphosphate aldolase 915 902 database:900
Rv0476 transmembrane protein 884 884 ctx neighborhood:882
Rv0477 hyp hypothetical protein 883 883 ctx neighborhood:882
Rv1438 tpi triosephosphate isomerase 881 845 database:800
Rv1436 gap glyceraldehyde 3-phosphate dehydrogenase 861 829 database:800
Rv0946c pgi glucose-6-phosphate isomerase 843 820 database:800
Rv1023 eno enolase 820 811 database:800
Rv1127c ppdK pyruvate, phosphate dikinase PpdK 811 811 database:800
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 808 808 database:800
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 808 808 database:800
Rv0650 sugar kinase 807 807 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 2-deoxyribose-5-phosphate aldolase
  • MTBC0 PGAP product: deoxyribose-phosphate aldolase
  • Pfam (hmmscan --cut_ga): DeoC PF01791.16 (E=8e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214992.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DeoC (PF01791.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0274
  • Curated reference: UniProt P9WP03 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor rbsK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000503|Rv0478|deoC
MLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCVSPSMVPVAVQAGGVRVAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGAALCGDIDAVRSDIEAVRAAAAGAVLKVIVESAVLLGQSNAHTLVDACRAAEDAGADFVKTSTGCHPAGGATVRAVELMAETVGPRLGVKASGGIRTAADAVAMLNAGATRLGLSGTRAVLDGLS