Rv0650 Family assigned · medium auto-curated
H37Rv Rv0650 · MTBC0 mtbc0_000688 ·
302 aa · 751123–752031 (+) ·
RefSeq NP_215164.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sugar kinase |
|---|---|
| MTBC0 PGAP re-annotation | ROK family protein |
| Revised (this work) | ROK family protein. Pfam: ROK (PF00480.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y8D3
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible sugar kinase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolismK Transcription
|
|---|---|
| eggNOG description | ROK family |
| Orthologous group | COG1940 |
| EC number |
EC 2.7.1.2
|
| KEGG orthology |
K00845
|
| KEGG pathways |
map00010, map00052, map00500, map00520, map00521, map00524, map01100, map01110, map01120, map01130, map01200
|
| KEGG modules |
M00001, M00549
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.014 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 5 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.29% of strains (418) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ROK | PF00480.27 | 1.3e-61 | 4–299 | ROK family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fabD2 (malonyl CoA-acyl carrier protein transacylase), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0649 fabD2 |
malonyl CoA-acyl carrier protein transacylase | 976 | 976 ctx | neighborhood:881 coexpression:810 |
Rv0648 |
alpha-mannosidase | 963 | 959 ctx | neighborhood:801 coexpression:745 |
Rv0946c pgi |
glucose-6-phosphate isomerase | 927 | 905 | database:900 |
Rv3068c pgmA |
phosphoglucomutase PgmA | 930 | 903 | database:900 |
Rv0046c ino1 |
inositol-3-phosphate synthase | 923 | 901 | database:900 |
Rv2702 ppgK |
polyphosphate glucokinase | 980 | 900 | database:900 textmining:816 |
Rv1448c tal |
transaldolase | 839 | 823 | database:800 |
Rv1999c |
transporter | 824 | 823 | coexpression:822 |
Rv1449c tkt |
transketolase | 891 | 817 | database:800 textmining:432 |
Rv1121 zwf1 |
glucose-6-phosphate 1-dehydrogenase | 895 | 811 | database:800 textmining:473 |
Rv1447c zwf2 |
glucose-6-phosphate 1-dehydrogenase | 893 | 809 | database:800 textmining:465 |
Rv0363c fba |
fructose-bisphosphate aldolase | 826 | 807 | database:800 |
Rv0478 deoC |
2-deoxyribose-5-phosphate aldolase | 807 | 807 | database:800 |
Rv0689c hyp |
hypothetical protein | 553 | 553 | coexpression:553 |
Rv0647c hyp |
hypothetical protein | 544 | 544 ctx | neighborhood:544 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sugar kinase
- MTBC0 PGAP product: ROK family protein
- Pfam (hmmscan --cut_ga): ROK PF00480.27 (E=1e-61)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215164.1)
- Domains: Pfam-A via hmmscan --cut_ga — ROK (PF00480.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1940 - Curated reference: UniProt I6Y8D3 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
fabD2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000688|Rv0650| MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAVGGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWLGAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVETIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAVCDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAAIA