Rv0650 Family assigned · medium auto-curated

H37Rv Rv0650 · MTBC0 mtbc0_000688 · 302 aa · 751123–752031 (+) · RefSeq NP_215164.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sugar kinase
MTBC0 PGAP re-annotationROK family protein
Revised (this work)ROK family protein. Pfam: ROK (PF00480.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y8D3 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible sugar kinase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
K Transcription
eggNOG descriptionROK family
Orthologous groupCOG1940
EC number EC 2.7.1.2
KEGG orthology K00845
KEGG pathways map00010, map00052, map00500, map00520, map00521, map00524, map01100, map01110, map01120, map01130, map01200
KEGG modules M00001, M00549

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.014 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.29% of strains (418) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ROKPF00480.27 1.3e-614–299 ROK family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fabD2 (malonyl CoA-acyl carrier protein transacylase), high confidence from genomic context alone (score 976 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0649 fabD2 malonyl CoA-acyl carrier protein transacylase 976 976 ctx neighborhood:881 coexpression:810
Rv0648 alpha-mannosidase 963 959 ctx neighborhood:801 coexpression:745
Rv0946c pgi glucose-6-phosphate isomerase 927 905 database:900
Rv3068c pgmA phosphoglucomutase PgmA 930 903 database:900
Rv0046c ino1 inositol-3-phosphate synthase 923 901 database:900
Rv2702 ppgK polyphosphate glucokinase 980 900 database:900 textmining:816
Rv1448c tal transaldolase 839 823 database:800
Rv1999c transporter 824 823 coexpression:822
Rv1449c tkt transketolase 891 817 database:800 textmining:432
Rv1121 zwf1 glucose-6-phosphate 1-dehydrogenase 895 811 database:800 textmining:473
Rv1447c zwf2 glucose-6-phosphate 1-dehydrogenase 893 809 database:800 textmining:465
Rv0363c fba fructose-bisphosphate aldolase 826 807 database:800
Rv0478 deoC 2-deoxyribose-5-phosphate aldolase 807 807 database:800
Rv0689c hyp hypothetical protein 553 553 coexpression:553
Rv0647c hyp hypothetical protein 544 544 ctx neighborhood:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sugar kinase
  • MTBC0 PGAP product: ROK family protein
  • Pfam (hmmscan --cut_ga): ROK PF00480.27 (E=1e-61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215164.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ROK (PF00480.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1940
  • Curated reference: UniProt I6Y8D3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor fabD2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000688|Rv0650|
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAVGGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWLGAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVETIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAVCDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAAIA