tal Resolved · high auto-curated
H37Rv Rv1448c · MTBC0 mtbc0_001550 ·
373 aa · 1636327–1637448 (-) ·
RefSeq NP_215964.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transaldolase |
|---|---|
| MTBC0 PGAP re-annotation | transaldolase |
| Revised (this work) | Transaldolase. Pfam: TAL_FSA (PF00923.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WG33
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transaldolase |
| EC (curated) |
EC 2.2.1.2
|
| Curated function | Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | tal |
| eggNOG description | Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway |
| Orthologous group | COG0176 |
| EC number |
EC 2.2.1.2
|
| KEGG orthology |
K00616
|
| KEGG pathways |
map00030, map01100, map01110, map01120, map01130, map01200, map01230
|
| KEGG modules |
M00004, M00007
|
| Gene Ontology (11) |
GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0040007, GO:0044424, GO:0044444, GO:0044464
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.339 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TAL_FSA | PF00923.26 | 1.3e-87 | 18–363 | Transaldolase/Fructose-6-phosphate aldolase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: tkt (transketolase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1449c tkt |
transketolase | 999 | 999 ctx | neighborhood:865 coexpression:859 database:900 textmining:745 |
Rv0946c pgi |
glucose-6-phosphate isomerase | 991 | 968 | coexpression:642 database:900 textmining:755 |
Rv1447c zwf2 |
glucose-6-phosphate 1-dehydrogenase | 983 | 966 ctx | neighborhood:881 coexpression:521 textmining:516 |
Rv0363c fba |
fructose-bisphosphate aldolase | 981 | 945 | coexpression:431 database:900 textmining:682 |
Rv2029c pfkB |
6-phosphofructokinase PfkB | 954 | 940 | coexpression:427 database:900 |
Rv1438 tpi |
triosephosphate isomerase | 969 | 908 | coexpression:440 database:800 textmining:680 |
Rv1099c glpX |
fructose 1,6-bisphosphatase | 950 | 908 | database:900 textmining:484 |
Rv3010c pfkA |
6-phosphofructokinase | 952 | 907 | database:900 textmining:514 |
Rv1445c devB |
6-phosphogluconolactonase | 933 | 907 ctx | neighborhood:811 |
Rv0478 deoC |
2-deoxyribose-5-phosphate aldolase | 917 | 906 | database:900 |
Rv3068c pgmA |
phosphoglucomutase PgmA | 933 | 895 | database:800 |
Rv1023 eno |
enolase | 977 | 893 | coexpression:429 database:800 textmining:797 |
Rv1436 gap |
glyceraldehyde 3-phosphate dehydrogenase | 952 | 888 | coexpression:445 database:800 textmining:593 |
Rv1617 pykA |
pyruvate kinase | 940 | 860 | database:800 textmining:588 |
Rv1446c opcA |
OXPP cycle protein OpcA | 924 | 853 ctx | neighborhood:811 textmining:509 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transaldolase
- MTBC0 PGAP product: transaldolase
- Pfam (hmmscan --cut_ga): TAL_FSA PF00923.26 (E=1e-87)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215964.1)
- Domains: Pfam-A via hmmscan --cut_ga — TAL_FSA (PF00923.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0176 - Curated reference: UniProt P9WG33 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
95 functional partner(s); context anchor
tkt - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001550|Rv1448c|tal MTAQNPNLAALSAAGVSVWLDDLSRDRLRSGNLQELIDTKSVVGVTTNPSIFQKALSEGHTYDAQIAELAARGADVDATIRTVTTDDVRSACDVLVPQWEDSDGVDGRVSIEVDPRLAHETEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQRYREVMDAYLTGMEKARQAGHSLSKIHSVASFFVSRVDTEIDKRLDRIGSRQALELRGQAGVANARLAYAAYREVFEDSDRYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPEKTIDAVADHGVIQGDTVTGTASDAQAVFDQLGAIGIDLTDVFAVLEEEGVRKFEASWNELLQETRAHLDTAAQ