tal Resolved · high auto-curated

H37Rv Rv1448c · MTBC0 mtbc0_001550 · 373 aa · 1636327–1637448 (-) · RefSeq NP_215964.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transaldolase
MTBC0 PGAP re-annotationtransaldolase
Revised (this work)Transaldolase. Pfam: TAL_FSA (PF00923.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG33 SwissProt · reviewed · Evidence at protein level
UniProt nameTransaldolase
EC (curated) EC 2.2.1.2
Curated functionTransaldolase is important for the balance of metabolites in the pentose-phosphate pathway.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nametal
eggNOG descriptionTransaldolase is important for the balance of metabolites in the pentose-phosphate pathway
Orthologous groupCOG0176
EC number EC 2.2.1.2
KEGG orthology K00616
KEGG pathways map00030, map01100, map01110, map01120, map01130, map01200, map01230
KEGG modules M00004, M00007
Gene Ontology (11) GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0040007, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.339 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TAL_FSAPF00923.26 1.3e-8718–363 Transaldolase/Fructose-6-phosphate aldolase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tkt (transketolase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1449c tkt transketolase 999 999 ctx neighborhood:865 coexpression:859 database:900 textmining:745
Rv0946c pgi glucose-6-phosphate isomerase 991 968 coexpression:642 database:900 textmining:755
Rv1447c zwf2 glucose-6-phosphate 1-dehydrogenase 983 966 ctx neighborhood:881 coexpression:521 textmining:516
Rv0363c fba fructose-bisphosphate aldolase 981 945 coexpression:431 database:900 textmining:682
Rv2029c pfkB 6-phosphofructokinase PfkB 954 940 coexpression:427 database:900
Rv1438 tpi triosephosphate isomerase 969 908 coexpression:440 database:800 textmining:680
Rv1099c glpX fructose 1,6-bisphosphatase 950 908 database:900 textmining:484
Rv3010c pfkA 6-phosphofructokinase 952 907 database:900 textmining:514
Rv1445c devB 6-phosphogluconolactonase 933 907 ctx neighborhood:811
Rv0478 deoC 2-deoxyribose-5-phosphate aldolase 917 906 database:900
Rv3068c pgmA phosphoglucomutase PgmA 933 895 database:800
Rv1023 eno enolase 977 893 coexpression:429 database:800 textmining:797
Rv1436 gap glyceraldehyde 3-phosphate dehydrogenase 952 888 coexpression:445 database:800 textmining:593
Rv1617 pykA pyruvate kinase 940 860 database:800 textmining:588
Rv1446c opcA OXPP cycle protein OpcA 924 853 ctx neighborhood:811 textmining:509

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transaldolase
  • MTBC0 PGAP product: transaldolase
  • Pfam (hmmscan --cut_ga): TAL_FSA PF00923.26 (E=1e-87)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215964.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TAL_FSA (PF00923.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0176
  • Curated reference: UniProt P9WG33 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 95 functional partner(s); context anchor tkt
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001550|Rv1448c|tal
MTAQNPNLAALSAAGVSVWLDDLSRDRLRSGNLQELIDTKSVVGVTTNPSIFQKALSEGHTYDAQIAELAARGADVDATIRTVTTDDVRSACDVLVPQWEDSDGVDGRVSIEVDPRLAHETEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQRYREVMDAYLTGMEKARQAGHSLSKIHSVASFFVSRVDTEIDKRLDRIGSRQALELRGQAGVANARLAYAAYREVFEDSDRYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPEKTIDAVADHGVIQGDTVTGTASDAQAVFDQLGAIGIDLTDVFAVLEEEGVRKFEASWNELLQETRAHLDTAAQ