Rv2186c Resolved · medium auto-curated

H37Rv Rv2186c · MTBC0 mtbc0_002321 · 129 aa · 2473612–2474001 (-) · RefSeq NP_216702.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationpolyketide cyclase / dehydrase and lipid transport
Revised (this work)Polyketide cyclase / dehydrase and lipid transport.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53520 TrEMBL · unreviewed · Evidence at protein level
UniProt namePolyketide cyclase / dehydrase and lipid transport

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionnegative regulation of translational initiation
Orthologous groupCOG2867

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3034c (acetyltransferase), high confidence from genomic context alone (score 770 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2418c octT hyp hypothetical protein 778 778 ctx cooccurence:772
Rv3038c hyp hypothetical protein 771 771 ctx cooccurence:771
Rv3034c acetyltransferase 769 770 ctx cooccurence:769
Rv3415c hyp hypothetical protein 763 763 ctx cooccurence:762
Rv3031 1,4-alpha-glucan-branching protein 749 749 ctx cooccurence:749
Rv2695 hyp hypothetical protein 748 749 ctx cooccurence:747
Rv1632c hyp hypothetical protein 717 717 ctx cooccurence:717
Rv3030 S-adenosylmethionine-dependent methyltransferase 707 696 ctx cooccurence:695
Rv3032 glycogen synthase 692 692 ctx cooccurence:683
Rv1111c hyp hypothetical protein 677 677 ctx cooccurence:677
Rv0383c ttfA hyp hypothetical protein 672 672 ctx cooccurence:672
Rv1459c mptB alpha-(1->6)-mannopyranosyltransferase 671 671 ctx cooccurence:671
Rv1109c hyp hypothetical protein 670 670 ctx cooccurence:668
Rv3212 hyp hypothetical protein 652 653 ctx cooccurence:642
Rv2732c transmembrane protein 643 643 ctx cooccurence:643

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: polyketide cyclase / dehydrase and lipid transport
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216702.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2867
  • Curated reference: UniProt O53520 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 63 functional partner(s); context anchor Rv3034c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002321|Rv2186c|
MNSIQIADETYVAADAARVSAAVADRCSWRRWWPDLRLQVTEDRADKGIRWTVTGALTGTMEIWLEPSMDGVLLHYFLHAEPTGVAAWQLARMNLARMTHHRRVAGKKMAFEVKTVLERSRPIGVSPVT