Rv2186c Resolved · medium auto-curated
H37Rv Rv2186c · MTBC0 mtbc0_002321 ·
129 aa · 2473612–2474001 (-) ·
RefSeq NP_216702.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | polyketide cyclase / dehydrase and lipid transport |
| Revised (this work) | Polyketide cyclase / dehydrase and lipid transport. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53520
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Polyketide cyclase / dehydrase and lipid transport |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | negative regulation of translational initiation |
| Orthologous group | COG2867 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3034c (acetyltransferase), high confidence from genomic context alone (score 770 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2418c octT hyp |
hypothetical protein | 778 | 778 ctx | cooccurence:772 |
Rv3038c hyp |
hypothetical protein | 771 | 771 ctx | cooccurence:771 |
Rv3034c |
acetyltransferase | 769 | 770 ctx | cooccurence:769 |
Rv3415c hyp |
hypothetical protein | 763 | 763 ctx | cooccurence:762 |
Rv3031 |
1,4-alpha-glucan-branching protein | 749 | 749 ctx | cooccurence:749 |
Rv2695 hyp |
hypothetical protein | 748 | 749 ctx | cooccurence:747 |
Rv1632c hyp |
hypothetical protein | 717 | 717 ctx | cooccurence:717 |
Rv3030 |
S-adenosylmethionine-dependent methyltransferase | 707 | 696 ctx | cooccurence:695 |
Rv3032 |
glycogen synthase | 692 | 692 ctx | cooccurence:683 |
Rv1111c hyp |
hypothetical protein | 677 | 677 ctx | cooccurence:677 |
Rv0383c ttfA hyp |
hypothetical protein | 672 | 672 ctx | cooccurence:672 |
Rv1459c mptB |
alpha-(1->6)-mannopyranosyltransferase | 671 | 671 ctx | cooccurence:671 |
Rv1109c hyp |
hypothetical protein | 670 | 670 ctx | cooccurence:668 |
Rv3212 hyp |
hypothetical protein | 652 | 653 ctx | cooccurence:642 |
Rv2732c |
transmembrane protein | 643 | 643 ctx | cooccurence:643 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: polyketide cyclase / dehydrase and lipid transport
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216702.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2867 - Curated reference: UniProt O53520 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
63 functional partner(s); context anchor
Rv3034c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002321|Rv2186c| MNSIQIADETYVAADAARVSAAVADRCSWRRWWPDLRLQVTEDRADKGIRWTVTGALTGTMEIWLEPSMDGVLLHYFLHAEPTGVAAWQLARMNLARMTHHRRVAGKKMAFEVKTVLERSRPIGVSPVT