Rv0556 Family assigned · low

H37Rv Rv0556 · MTBC0 mtbc0_000585 · 171 aa · 651510–652025 (+) · RefSeq NP_215070.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF3592 domain-containing protein
Revised (this work)Polymorphic-toxin / contact-dependent immunity-protein-like fold (Tsi4-like). RefSeq leaves it 'membrane protein'.

Curated reference (UniProt)

UniProt O06422 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EDS1

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.568 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: menD (bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0555 menD bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase 884 884 ctx neighborhood:882
Rv0554 bpoC non-heme bromoperoxidase BpoC 821 821 ctx neighborhood:820
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 799 800 ctx neighborhood:800
Rv2446c integral membrane protein 778 778 ctx cooccurence:774
Rv3212 hyp hypothetical protein 777 777 ctx cooccurence:774
Rv1632c hyp hypothetical protein 776 776 ctx cooccurence:773
Rv3438 hyp hypothetical protein 774 775 ctx cooccurence:774
Rv3850 hyp hypothetical protein 774 775 ctx cooccurence:774
Rv2732c transmembrane protein 774 774 ctx cooccurence:773
Rv1109c hyp hypothetical protein 774 774 ctx cooccurence:773
Rv3205c hyp hypothetical protein 773 774 ctx cooccurence:773
Rv0996 transmembrane protein 772 773 ctx cooccurence:772
Rv0358 hyp hypothetical protein 772 772 ctx cooccurence:772
Rv2049c hyp hypothetical protein 771 772 ctx cooccurence:771
Rv2138 lppL lipoprotein LppL 771 771 ctx cooccurence:770

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: immune protein Tsi4, TM 0.54, E 2e-6
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215070.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EDS1
  • Curated reference: UniProt O06422 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 150 functional partner(s); context anchor menD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000585|Rv0556|
MISPKPLLHILIHGRSDELPDTRGRIVLRWLRIAVLIVTGLVTLQSVLLVAGAWRNDIAIQRNMGVAQAEVLSAGPRRSTIEFVTPDRITYRPQLGVLYPSELSTGMRIYVEYNKRDPNLVRVQHRNAGLAIIPAGSIAVVAWLIAAAALVVLAVLDKRLERRENSASATG