Rv3217c Still unknown · low auto-curated

H37Rv Rv3217c · MTBC0 mtbc0_003423 · 143 aa · 3615946–3616377 (-) · RefSeq NP_217733.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05849 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DTKM

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2732c (transmembrane protein), high confidence from genomic context alone (score 771 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0358 hyp hypothetical protein 774 774 ctx cooccurence:765
Rv2732c transmembrane protein 771 771 ctx cooccurence:765
Rv2446c integral membrane protein 769 769 ctx cooccurence:766
Rv0556 transmembrane protein 761 762 ctx cooccurence:761
Rv1083 hyp hypothetical protein 761 761 ctx cooccurence:760
Rv3438 hyp hypothetical protein 754 755 ctx cooccurence:754
Rv3205c hyp hypothetical protein 753 754 ctx cooccurence:746
Rv0863 hyp hypothetical protein 751 751 ctx cooccurence:748
Rv0996 transmembrane protein 750 751 ctx cooccurence:750
Rv3218 hyp hypothetical protein 747 748 ctx neighborhood:748
Rv3212 hyp hypothetical protein 730 730 ctx cooccurence:726
Rv1109c hyp hypothetical protein 727 728 ctx cooccurence:726
Rv3311 hyp hypothetical protein 718 718 ctx cooccurence:718
Rv0475 hbhA heparin binding hemagglutinin HbhA 717 718 ctx cooccurence:717
Rv3415c hyp hypothetical protein 715 716 ctx cooccurence:715

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217733.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DTKM
  • Curated reference: UniProt O05849 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 100 functional partner(s); context anchor Rv2732c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003423|Rv3217c|
MPVRAPAAVRGAGLIVAVQGGAALVVAAALLVRGLAGADQHIVNGLGTAGWFVLVGGAVLAAGCRLAVGKLWGRGLAVFAQLLLLPVAWYLIVGSHQPAIGIPVGIIALGVLVLLFSPPSIRWAAGRDQRGAASAANRGPDSR