lprG Resolved · high auto-curated
H37Rv Rv1411c · MTBC0 mtbc0_001512 ·
236 aa ·
1597116–1597826 MTBC0
(-) ·
RefSeq NP_215927.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LprG |
|---|---|
| MTBC0 PGAP re-annotation | lipoarabinomannan carrier protein LprG |
| Revised (this work) | Lipoarabinomannan carrier protein LprG. Pfam: LppX_LprAFG (PF07161.20). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 55 publications
55 TB publications mention this gene. 55 publication(s) discuss this gene (49 in a M. tuberculosis context, 12 in other mycobacteria — M. smegmatis (10), M. abscessus (3)).
| Publication | Date |
|---|---|
| Extracellular Vesicles of Mycobacterium tuberculosis Serve as a Virulence Factor - Current Research Applications. doi:10.1007/s00284-026-04978-z | 2026 |
| CRISPR-based genome editing reveals the roles of efflux pumps in Mycobacterium abscessus. doi:10.1002/mlf2.70048 | 2026 |
| A highly conserved two-gene operon is crucial for lipoarabinomannan localization, pathogenesis, and cell envelope function in Mycobacterium abscessus. doi:10.64898/2026.01.29.702501 | 2026 |
| Protein-Mediated Virulence in Mycobacterium tuberculosis. doi:10.1007/978-3-031-96883-9_5 | 2026 |
| Challenges and Potential of Antibody-Drug Conjugates as Prospective Tuberculosis Therapeutics. doi:10.3390/microorganisms13102234 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 17% of residues (metapredict) · mean AlphaFold pLDDT 90.6 |
|---|---|
| Disordered regions | 1 IDR(s), longest 41 aa [0-41] |
carries a substantial disordered region (41/236 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -1.14 (95% CI -2.24 to 0.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1446c
· 100.0% identity |
|---|---|
| M. leprae |
ML0557c
· 68.1% identity |
| M. marinum |
MMAR_2220
· 79.4% identity |
| M. smegmatis |
MSMEG_3070
· 54.5% identity |
| M. orygis |
RJtmp_001491
· 100.0% identity |
| M. abscessus |
MAB_2806
· 42.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WK45
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Lipoarabinomannan carrier protein LprG |
| Curated function | Helps membrane protein Rv1410c (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm; TAG probably regulates lipid metabolism and growth regulation and plays a structural role in the outer membrane. Binds TAG in its hydrophobic cavity and transfers it between lipid bilayers, probably to the outer membrane in vivo. Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2. Binds LM > PIM6 > ManLAM > PI-LAM > PIM2 (mannose-capped . |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | lprG |
| eggNOG description | (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm and probably ultimately to the outer membrane |
| Orthologous group | 2DQVM |
| KEGG orthology |
K14954, K14955
|
| KEGG pathways |
map05152
|
| Gene Ontology (29) |
GO:0003674, GO:0005488, GO:0005543, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0008289, GO:0009405, GO:0016020 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.019 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 69.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 37.8% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 0.889, mean read count 111.375. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 45 (in vivo) | -7.28 | 0.0 | required |
| altered fitness under Vancomycin (drug exposure) | -6.19 | 0.0 | required |
| altered fitness under Rifampicin (drug exposure) | -5.28 | 0.0 | required |
| fitness in mouse infection (in vivo) | +4.43 | 0.0091 | disruption advantageous |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -4.31 | 0.0 | required |
| altered fitness under Ethambutol (drug exposure) | -2.52 | 0.032 | required |
Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1514.0 ppm · rank 135/3519 (96.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) lipoprotein
| Prediction | predicted lipoprotein (lipobox + signal peptide) |
|---|---|
| DeepTMHMM class | SP |
| Lipobox | signal-peptidase-II lipobox; lipidated Cys near position 27 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 236 aa |
|---|---|
| Molecular weight | 24.5 kDa |
| Theoretical pI | 7.78 |
| GRAVY | -0.127 (hydrophilic) |
| Aliphatic index | 86.9 |
| Aromaticity | 0.042 |
| Instability index | 16.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LppX_LprAFG | PF07161.20 | 3.6e-83 | 40–230 | LppX_LprAFG lipoprotein |
Experimental structures (Protein Data Bank) 4 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3mh9 |
X-ray diffraction | 1.794 Å | 99% |
4zra |
X-ray diffraction | 1.83 Å | 93% |
3mha |
X-ray diffraction | 1.85 Å | 93% |
3mh8 |
X-ray diffraction | 1.995 Å | 93% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3mh9-assembly2_C |
1.00 | 0.99 | 1.2e-36 sig | 3mh9-assembly2_C Crystal structure of LprG mutant V91W from Mycobacterium tuberculosis |
3mha-assembly2_B |
1.00 | 0.98 | 1.2e-35 sig | 3mha-assembly2_B Crystal structure of LprG from Mycobacterium tuberculosis bound to PIM |
3mh8-assembly2_B |
1.00 | 0.98 | 6.9e-34 sig | 3mh8-assembly2_B Crystal structure of LprG from Mycobacterium tuberculosis |
4qa8-assembly1_A |
1.00 | 0.85 | 3.0e-18 sig | 4qa8-assembly1_A Crystal structure of LprF from Mycobacterium bovis |
2byo-assembly1_A |
1.00 | 0.79 | 5.1e-15 sig | 2byo-assembly1_A Crystal structure of Mycobacterium tuberculosis lipoprotein LppX (Rv2945c) |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv1410c (- strand, 5 bp gap) |
|---|---|
| Downstream (3' on genome) | ribC (+ strand, 84 bp gap) |
| Predicted operon |
Rv1410c · lprG
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1410c (aminoglycosides/tetracycline-transport integral membrane protein), high confidence from genomic context alone (score 972 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1410c |
aminoglycosides/tetracycline-transport integral membrane protein | 989 | 972 ctx | neighborhood:881 cooccurence:701 textmining:657 |
Rv1412 ribC |
riboflavin synthase | 786 | 786 ctx | neighborhood:783 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 579 | 580 ctx | cooccurence:577 |
Rv2695 hyp |
hypothetical protein | 570 | 570 ctx | cooccurence:570 |
Rv3415c hyp |
hypothetical protein | 564 | 564 ctx | cooccurence:564 |
Rv2743c hyp |
hypothetical protein | 539 | 540 ctx | cooccurence:535 |
Rv0470c pcaA |
cyclopropane mycolic acid synthase | 533 | 533 | coexpression:533 |
Rv0674 hyp |
hypothetical protein | 493 | 494 ctx | cooccurence:486 |
Rv2557 hyp |
hypothetical protein | 493 | 494 ctx | cooccurence:487 |
Rv1365c rsfA |
anti-sigma-F factor antagonist RsfA | 492 | 492 ctx | cooccurence:492 |
Rv2558 hyp |
hypothetical protein | 489 | 489 ctx | cooccurence:486 |
Rv3217c |
integral membrane protein | 479 | 479 ctx | cooccurence:476 |
Rv2091c |
membrane protein | 477 | 478 ctx | cooccurence:449 |
Rv0910 |
toxin | 463 | 464 ctx | cooccurence:461 |
Rv1546 hyp |
hypothetical protein | 460 | 461 ctx | cooccurence:459 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoprotein LprG
- MTBC0 PGAP product: lipoarabinomannan carrier protein LprG
- Pfam (hmmscan --cut_ga): LppX_LprAFG PF07161.20 (E=4e-83)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215927.1)
- Domains: Pfam-A via hmmscan --cut_ga — LppX_LprAFG (PF07161.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DQVM - Curated reference: UniProt P9WK45 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
Rv1410c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001512|Rv1411c|lprG MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lprG? Email the maintainer — the message is pre-filled with this gene's details.