lprG Resolved · high auto-curated
H37Rv Rv1411c · MTBC0 mtbc0_001512 ·
236 aa · 1597116–1597826 (-) ·
RefSeq NP_215927.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LprG |
|---|---|
| MTBC0 PGAP re-annotation | lipoarabinomannan carrier protein LprG |
| Revised (this work) | Lipoarabinomannan carrier protein LprG. Pfam: LppX_LprAFG (PF07161.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WK45
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Lipoarabinomannan carrier protein LprG |
| Curated function | Helps membrane protein Rv1410c (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm; TAG probably regulates lipid metabolism and growth regulation and plays a structural role in the outer membrane. Binds TAG in its hydrophobic cavity and transfers it between lipid bilayers, probably to the outer membrane in vivo. Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2. Binds LM > PIM6 > ManLAM > PI-LAM > PIM2 (mannose-capped . |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | lprG |
| eggNOG description | (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm and probably ultimately to the outer membrane |
| Orthologous group | 2DQVM |
| KEGG orthology |
K14954, K14955
|
| KEGG pathways |
map05152
|
| Gene Ontology (29) |
GO:0003674, GO:0005488, GO:0005543, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0008289, GO:0009405, GO:0016020 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.019 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LppX_LprAFG | PF07161.20 | 3.6e-83 | 40–230 | LppX_LprAFG lipoprotein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1410c (aminoglycosides/tetracycline-transport integral membrane protein), high confidence from genomic context alone (score 972 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1410c |
aminoglycosides/tetracycline-transport integral membrane protein | 989 | 972 ctx | neighborhood:881 cooccurence:701 textmining:657 |
Rv1412 ribC |
riboflavin synthase | 786 | 786 ctx | neighborhood:783 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 579 | 580 ctx | cooccurence:577 |
Rv2695 hyp |
hypothetical protein | 570 | 570 ctx | cooccurence:570 |
Rv3415c hyp |
hypothetical protein | 564 | 564 ctx | cooccurence:564 |
Rv2743c hyp |
hypothetical protein | 539 | 540 ctx | cooccurence:535 |
Rv0470c pcaA |
cyclopropane mycolic acid synthase | 533 | 533 | coexpression:533 |
Rv0674 hyp |
hypothetical protein | 493 | 494 ctx | cooccurence:486 |
Rv2557 hyp |
hypothetical protein | 493 | 494 ctx | cooccurence:487 |
Rv1365c rsfA |
anti-sigma-F factor antagonist RsfA | 492 | 492 ctx | cooccurence:492 |
Rv2558 hyp |
hypothetical protein | 489 | 489 ctx | cooccurence:486 |
Rv3217c |
integral membrane protein | 479 | 479 ctx | cooccurence:476 |
Rv2091c |
membrane protein | 477 | 478 ctx | cooccurence:449 |
Rv0910 |
toxin | 463 | 464 ctx | cooccurence:461 |
Rv1546 hyp |
hypothetical protein | 460 | 461 ctx | cooccurence:459 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoprotein LprG
- MTBC0 PGAP product: lipoarabinomannan carrier protein LprG
- Pfam (hmmscan --cut_ga): LppX_LprAFG PF07161.20 (E=4e-83)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215927.1)
- Domains: Pfam-A via hmmscan --cut_ga — LppX_LprAFG (PF07161.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DQVM - Curated reference: UniProt P9WK45 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
Rv1410c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001512|Rv1411c|lprG MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS