lprG Resolved · high auto-curated

H37Rv Rv1411c · MTBC0 mtbc0_001512 · 236 aa · 1597116–1597826 (-) · RefSeq NP_215927.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LprG
MTBC0 PGAP re-annotationlipoarabinomannan carrier protein LprG
Revised (this work)Lipoarabinomannan carrier protein LprG. Pfam: LppX_LprAFG (PF07161.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK45 SwissProt · reviewed · Evidence at protein level
UniProt nameLipoarabinomannan carrier protein LprG
Curated functionHelps membrane protein Rv1410c (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm; TAG probably regulates lipid metabolism and growth regulation and plays a structural role in the outer membrane. Binds TAG in its hydrophobic cavity and transfers it between lipid bilayers, probably to the outer membrane in vivo. Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2. Binds LM > PIM6 > ManLAM > PI-LAM > PIM2 (mannose-capped .

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelprG
eggNOG description(P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm and probably ultimately to the outer membrane
Orthologous group2DQVM
KEGG orthology K14954, K14955
KEGG pathways map05152
Gene Ontology (29) GO:0003674, GO:0005488, GO:0005543, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0008289, GO:0009405, GO:0016020 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.019 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LppX_LprAFGPF07161.20 3.6e-8340–230 LppX_LprAFG lipoprotein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1410c (aminoglycosides/tetracycline-transport integral membrane protein), high confidence from genomic context alone (score 972 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1410c aminoglycosides/tetracycline-transport integral membrane protein 989 972 ctx neighborhood:881 cooccurence:701 textmining:657
Rv1412 ribC riboflavin synthase 786 786 ctx neighborhood:783
Rv0290 eccD3 ESX-3 secretion system protein EccD 579 580 ctx cooccurence:577
Rv2695 hyp hypothetical protein 570 570 ctx cooccurence:570
Rv3415c hyp hypothetical protein 564 564 ctx cooccurence:564
Rv2743c hyp hypothetical protein 539 540 ctx cooccurence:535
Rv0470c pcaA cyclopropane mycolic acid synthase 533 533 coexpression:533
Rv0674 hyp hypothetical protein 493 494 ctx cooccurence:486
Rv2557 hyp hypothetical protein 493 494 ctx cooccurence:487
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 492 492 ctx cooccurence:492
Rv2558 hyp hypothetical protein 489 489 ctx cooccurence:486
Rv3217c integral membrane protein 479 479 ctx cooccurence:476
Rv2091c membrane protein 477 478 ctx cooccurence:449
Rv0910 toxin 463 464 ctx cooccurence:461
Rv1546 hyp hypothetical protein 460 461 ctx cooccurence:459

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LprG
  • MTBC0 PGAP product: lipoarabinomannan carrier protein LprG
  • Pfam (hmmscan --cut_ga): LppX_LprAFG PF07161.20 (E=4e-83)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215927.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LppX_LprAFG (PF07161.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DQVM
  • Curated reference: UniProt P9WK45 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor Rv1410c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001512|Rv1411c|lprG
MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS