Rv3034c Resolved · high auto-curated

H37Rv Rv3034c · MTBC0 - · 300 aa · 3394019–3394921 (-) · RefSeq NP_217550.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acetyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Acetyltransferase. Pfam: Hexapep (PF00132.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53281 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable acetyltransferase Rv3034c
EC (curated) EC 2.3.1.-
Curated functionMay be involved in the biosynthesis of 6-O-methylglucosyl-containing lipopolysaccharides (MGLP)..; FUNCTION: Regulates host peroxisome homeostasis in response to intracellular redox levels to favor mycobacterial infection in macrophage. Induces the expression of host peroxisome biogenesis and proliferation factors as well as peroxisome associated enzymes. Inhibits the induction of host pexophagy mechanism by down-regulating the expression of pexophagy associated proteins and adapter molecules in infected macrophages. However, during increased oxidative stress conditions, it induces degradation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionacetyltransferase
Orthologous groupCOG0110
EC number EC 2.3.1.79
KEGG orthology K00661
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.518 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HexapepPF00132.31 2.1e-08219–253 Bacterial transferase hexapeptide (six repeats)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3030 (S-adenosylmethionine-dependent methyltransferase), medium confidence from genomic context alone (score 648 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3038c hyp hypothetical protein 799 799 ctx cooccurence:764
Rv2186c hyp hypothetical protein 769 770 ctx cooccurence:769
Rv2418c octT hyp hypothetical protein 945 731 ctx cooccurence:721 textmining:807
Rv3030 S-adenosylmethionine-dependent methyltransferase 953 648 ctx cooccurence:635 textmining:873
Rv3031 1,4-alpha-glucan-branching protein 924 631 ctx cooccurence:630 textmining:803
Rv3032 glycogen synthase 948 627 ctx cooccurence:590 textmining:868
Rv2695 hyp hypothetical protein 584 584 ctx cooccurence:578
Rv3415c hyp hypothetical protein 530 531 ctx cooccurence:529
Rv1632c hyp hypothetical protein 458 459 ctx cooccurence:453
Rv1459c mptB alpha-(1->6)-mannopyranosyltransferase 479 456 ctx cooccurence:409
Rv2174 mptA alpha(1->6)-mannopyranosyltransferase A 446 421
Rv1503c Rv1503c, (MTCY277.25c), len: 182 aa. Conserved hypothetical protein, similar to C-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi 442 408
Rv3402c hyp hypothetical protein 439 404
Rv1504c Rv1504c, (MTCY277.26c), len: 199 aa. Conserved hypothetical protein, similar to N-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi 439 404
Rv1519 hyp hypothetical protein 439 404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): acetyltransferase
  • Pfam (hmmscan --cut_ga): Hexapep PF00132.31 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217550.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Hexapep (PF00132.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0110
  • Curated reference: UniProt O53281 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor Rv3030
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3034c|
MNVLSLGSSSGVVWGRVPITAPAGAATGVTSRADAHSQMRRYAQTGPTAKLSSAPMTTMWGAPLHRRWRGSRLRDPRQAKFLTLASLKWVLANRAYTPWYLVRYWRLLRFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWVHIGDKNTIRAHEGSLRFGDKVVLGRDNVINTYLDIEIGDSVLMADWCYICDFDHRMDDITLPIKDQGIIKSPVRIGPDTWIGVKVSVLRGTTIGRGCVLGSHAVVRGAIPDYSIAVGAPAKVVKNRQLSWEASAAQRAELAAALADIERKKAAR