Rv2091c Family assigned · low
H37Rv Rv2091c · MTBC0 mtbc0_002225 ·
244 aa ·
2377182–2377916 MTBC0
(-) ·
RefSeq NP_216607.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4333 domain-containing protein |
| Revised (this work) | Membrane protein (1 predicted TM helix, DUF4333) co-transcribed with tatC and tatA — the twin-arginine translocation (Tat) protein-secretion system — under purifying selection. Contextual candidate: associated with the Tat secretion system. Its molecular role is not established. |
| Functional category (TubercuList) | cell wall and cell processes |
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 55% of residues (metapredict) · mean AlphaFold pLDDT 57.5 |
|---|---|
| Disordered regions | 1 IDR(s), longest 134 aa [0-134] |
carries a substantial disordered region (134/244 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Operon-context functional lead (hypothesis)
Co-transcribed within the operon Rv2091c-helY-tatC-tatA,
pointing to Tat protein secretion.
Basis: co-transcription in operon Rv2091c-helY-tatC-tatA + purifying selection. This is a contextual candidate association (guilt-by-co-transcription), not an established molecular function.
CRISPRi vulnerability
Vulnerability index 1.41 (95% CI -0.63 to 4.84). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2118c
· 100.0% identity |
|---|---|
| M. leprae |
ML1334
· 59.2% identity |
| M. marinum |
MMAR_3077
· 69.6% identity |
| M. smegmatis |
MSMEG_3884
· 65.2% identity |
| M. orygis |
RJtmp_002161
· 100.0% identity |
| M. abscessus |
MAB_2190
· 49.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WLJ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2091c |
UniProt still lists this protein as Uncharacterized protein Rv2091c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4333) |
| Orthologous group | 2BYFJ |
| Gene Ontology (14) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0030312, GO:0031224, GO:0031226, GO:0044425, GO:0044459 +2 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.417 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 1/53 (2%) · mean identity 87.7%
· 1/4 closest MTBAP relatives present in a subset of the genus (1/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 20 in the ORF — 0 in the essential state, 0 growth-defect, 20 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 122.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 45 (in vivo) | -6.35 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.51 | 0.0 | required |
| fitness after prolonged in vitro passage (in vitro passage) | -5.40 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.26 | 0.0 | required |
| fitness in mouse infection (in vivo) | -5.10 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.92 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.89 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.86 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.47 | 0.0 | required |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | +4.24 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | -4.22 | 0.0 | required |
| fitness in mouse infection (in vivo) | -4.11 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 55 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 795.0 ppm · rank 284/3519 (92.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 244 aa |
|---|---|
| Molecular weight | 26.0 kDa |
| Theoretical pI | 5.76 |
| GRAVY | -0.685 (hydrophilic) |
| Aliphatic index | 50.0 |
| Aromaticity | 0.111 |
| Instability index | 41.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4333 | PF14230.12 | 8.8e-25 | 154–236 | Domain of unknown function (DUF4333) |
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv2090 (+ strand, 3 bp gap) |
|---|---|
| Downstream (3' on genome) | helY (- strand, 41 bp gap) |
| Predicted operon |
Rv2091c · helY · tatC · tatA
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2520c (membrane protein), high confidence from genomic context alone (score 757 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1109c hyp |
hypothetical protein | 781 | 781 ctx | cooccurence:771 |
Rv3212 hyp |
hypothetical protein | 767 | 767 ctx | cooccurence:766 |
Rv3311 hyp |
hypothetical protein | 759 | 759 ctx | cooccurence:758 |
Rv2700 cei hyp |
hypothetical protein | 758 | 758 ctx | cooccurence:758 |
Rv2520c |
membrane protein | 756 | 757 ctx | cooccurence:756 |
Rv0556 |
transmembrane protein | 755 | 755 ctx | cooccurence:754 |
Rv0996 |
transmembrane protein | 753 | 753 ctx | cooccurence:752 |
Rv0863 hyp |
hypothetical protein | 750 | 751 ctx | cooccurence:748 |
Rv2446c |
integral membrane protein | 750 | 751 ctx | cooccurence:750 |
Rv0481c hyp |
hypothetical protein | 750 | 750 ctx | cooccurence:750 |
Rv1209 hyp |
hypothetical protein | 757 | 748 ctx | cooccurence:745 |
Rv1222 rseA |
anti-sigma E factor RseA | 744 | 745 ctx | cooccurence:741 |
Rv3415c hyp |
hypothetical protein | 741 | 741 ctx | cooccurence:741 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 741 | 741 ctx | cooccurence:738 |
Rv2138 lppL |
lipoprotein LppL | 739 | 739 ctx | cooccurence:738 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein
- MTBC0 PGAP product: DUF4333 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF4333 PF14230.12 (E=9e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216607.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4333 (PF14230.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BYFJ - Curated reference: UniProt P9WLJ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
115 functional partner(s); context anchor
Rv2520c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002225|Rv2091c| MSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYTPQYQQPADPAYPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQYGQPGQYGQPGQYAPPGQYPGQYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGAVLILGFWAPGFFVTTKLDVIKAQAGVQQVLTDETTGYGAKNVKDVKCNNGSDPTVKKGATFECTVSIDGTSKRVTVTFQDNKGTYEVGRPQ
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2091c? Email the maintainer — the message is pre-filled with this gene's details.