Rv2669 Resolved · high auto-curated
H37Rv Rv2669 · MTBC0 mtbc0_002843 ·
156 aa · 3007486–3007956 (+) ·
RefSeq NP_217185.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | N-acetyltransferase |
| Revised (this work) | N-acetyltransferase. Pfam: Acetyltransf_3 (PF13302.14), Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQG5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized N-acetyltransferase Rv2669 |
| EC (curated) |
EC 2.3.1.-
|
UniProt still lists this protein as Uncharacterized N-acetyltransferase Rv2669; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | acetyltransferase |
| Orthologous group | COG0454 |
| EC number |
EC 2.3.1.57
|
| KEGG orthology |
K22441
|
| Gene Ontology (20) |
GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0008080, GO:0008150, GO:0016407, GO:0016410, GO:0016740, GO:0016746 +8 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_3 | PF13302.14 | 2.3e-06 | 19–132 | Acetyltransferase (GNAT) domain |
Acetyltransf_10 | PF13673.14 | 3.9e-15 | 22–142 | Acetyltransferase (GNAT) domain |
Acetyltransf_1 | PF00583.32 | 4.4e-20 | 38–131 | Acetyltransferase (GNAT) family |
Acetyltransf_7 | PF13508.14 | 1.6e-13 | 50–132 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: trmD (tRNA (guanine-N1)-methyltransferase), high confidence from genomic context alone (score 836 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2668 hyp |
hypothetical protein | 841 | 841 ctx | neighborhood:839 |
Rv2906c trmD |
tRNA (guanine-N1)-methyltransferase | 837 | 836 ctx | fusion:832 |
Rv2667 clpC2 |
ATP-dependent protease ATP-binding subunit ClpC | 768 | 760 ctx | neighborhood:758 |
Rv2803 hyp |
hypothetical protein | 473 | 471 | experimental:451 |
Rv0918 hyp |
hypothetical protein | 472 | 470 | experimental:451 |
Rv2666 |
Probable transposase for insertion sequence element IS1081 (fragment); Required for the transposition of the insertion element. | 458 | 458 ctx | neighborhood:458 |
Rv3421c tsaB hyp |
hypothetical protein | 479 | 446 | |
Rv3225c |
GCN5-like N-acetyltransferase | 569 | 206 | textmining:480 |
Rv1569 bioF1 |
8-amino-7-oxononanoate synthase | 533 | 201 | textmining:440 |
Rv2747 argA |
L-glutamate alpha-N-acetyltranferase | 424 | 200 | |
Rv3027c |
GCN5-like N-acetyltransferase | 752 | 81 | textmining:742 |
Rv3566c nat |
arylamine N-acetyltransferase | 661 | 51 | textmining:658 |
Rv1867 hyp |
hypothetical protein | 652 | 51 | textmining:649 |
Rv1135A |
Rv1135A, len: 80 aa. Possible acetyl-CoA acetyltransferase (possible gene fragment), highly similar to other acetyl-CoA acetyltransferases e | 658 | 44 | textmining:657 |
Rv3523 ltp3 |
lipid carrier protein | 516 | 44 | textmining:515 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_3 PF13302.14 (E=2e-06), Acetyltransf_10 PF13673.14 (E=4e-15), Acetyltransf_1 PF00583.32 (E=4e-20), Acetyltransf_7 PF13508.14 (E=2e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217185.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_3 (PF13302.14), Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt P9WQG5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
17 functional partner(s); context anchor
trmD - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002843|Rv2669| MTDADELAAVAARTFPLACPPAVAPEHIASFVDANLSSARFAEYLTDPRRAILTARHDGRIVGYAMLIRGDDRDVELSKLYLLPGYHGTGAAAALMHKVLATAADWGALRVWLGVNQKNQRAQRFYAKTGFKINGTRTFRLGAHHENDYVMVRELV