Rv2669 Resolved · high auto-curated

H37Rv Rv2669 · MTBC0 mtbc0_002843 · 156 aa · 3007486–3007956 (+) · RefSeq NP_217185.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GCN5-like N-acetyltransferase
MTBC0 PGAP re-annotationN-acetyltransferase
Revised (this work)N-acetyltransferase. Pfam: Acetyltransf_3 (PF13302.14), Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQG5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized N-acetyltransferase Rv2669
EC (curated) EC 2.3.1.-

UniProt still lists this protein as Uncharacterized N-acetyltransferase Rv2669; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionacetyltransferase
Orthologous groupCOG0454
EC number EC 2.3.1.57
KEGG orthology K22441
Gene Ontology (20) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0008080, GO:0008150, GO:0016407, GO:0016410, GO:0016740, GO:0016746 +8 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_3PF13302.14 2.3e-0619–132 Acetyltransferase (GNAT) domain
Acetyltransf_10PF13673.14 3.9e-1522–142 Acetyltransferase (GNAT) domain
Acetyltransf_1PF00583.32 4.4e-2038–131 Acetyltransferase (GNAT) family
Acetyltransf_7PF13508.14 1.6e-1350–132 Acetyltransferase (GNAT) domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trmD (tRNA (guanine-N1)-methyltransferase), high confidence from genomic context alone (score 836 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2668 hyp hypothetical protein 841 841 ctx neighborhood:839
Rv2906c trmD tRNA (guanine-N1)-methyltransferase 837 836 ctx fusion:832
Rv2667 clpC2 ATP-dependent protease ATP-binding subunit ClpC 768 760 ctx neighborhood:758
Rv2803 hyp hypothetical protein 473 471 experimental:451
Rv0918 hyp hypothetical protein 472 470 experimental:451
Rv2666 Probable transposase for insertion sequence element IS1081 (fragment); Required for the transposition of the insertion element. 458 458 ctx neighborhood:458
Rv3421c tsaB hyp hypothetical protein 479 446
Rv3225c GCN5-like N-acetyltransferase 569 206 textmining:480
Rv1569 bioF1 8-amino-7-oxononanoate synthase 533 201 textmining:440
Rv2747 argA L-glutamate alpha-N-acetyltranferase 424 200
Rv3027c GCN5-like N-acetyltransferase 752 81 textmining:742
Rv3566c nat arylamine N-acetyltransferase 661 51 textmining:658
Rv1867 hyp hypothetical protein 652 51 textmining:649
Rv1135A Rv1135A, len: 80 aa. Possible acetyl-CoA acetyltransferase (possible gene fragment), highly similar to other acetyl-CoA acetyltransferases e 658 44 textmining:657
Rv3523 ltp3 lipid carrier protein 516 44 textmining:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GCN5-like N-acetyltransferase
  • MTBC0 PGAP product: N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_3 PF13302.14 (E=2e-06), Acetyltransf_10 PF13673.14 (E=4e-15), Acetyltransf_1 PF00583.32 (E=4e-20), Acetyltransf_7 PF13508.14 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217185.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_3 (PF13302.14), Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0454
  • Curated reference: UniProt P9WQG5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor trmD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002843|Rv2669|
MTDADELAAVAARTFPLACPPAVAPEHIASFVDANLSSARFAEYLTDPRRAILTARHDGRIVGYAMLIRGDDRDVELSKLYLLPGYHGTGAAAALMHKVLATAADWGALRVWLGVNQKNQRAQRFYAKTGFKINGTRTFRLGAHHENDYVMVRELV