trmD Resolved · high auto-curated

H37Rv Rv2906c · MTBC0 mtbc0_003088 · 230 aa · 3236494–3237186 (-) · RefSeq NP_217422.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tRNA (guanine-N1)-methyltransferase
MTBC0 PGAP re-annotationtRNA (guanosine(37)-N1)-methyltransferase TrmD
Revised (this work)TRNA (guanosine(37)-N1)-methyltransferase TrmD. Pfam: tRNA_m1G_MT (PF01746.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFY7 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA
EC (curated) EC 2.1.1.228
Curated functionSpecifically methylates guanosine-37 in various tRNAs.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametrmD
eggNOG descriptionBelongs to the RNA methyltransferase TrmD family
Orthologous groupCOG0336
EC number EC 2.1.1.228
KEGG orthology K00554
Gene Ontology (46) GO:0001510, GO:0003674, GO:0003824, GO:0006139, GO:0006396, GO:0006399, GO:0006400, GO:0006725, GO:0006807, GO:0008033, GO:0008150, GO:0008152 +34 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.346 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA_m1G_MTPF01746.27 8.6e-931–227 tRNA (Guanine-1)-methyltransferase TrmD

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rimM (16S rRNA processing protein RimM), high confidence from genomic context alone (score 985 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2907c rimM 16S rRNA processing protein RimM 989 985 ctx neighborhood:882 coexpression:875
Rv2909c rpsP 30S ribosomal protein S16 982 975 ctx neighborhood:799 coexpression:858
Rv1307 atpH ATP synthase subunit b/delta 981 970 coexpression:968 textmining:413
Rv2904c rplS 50S ribosomal protein L19 976 967 ctx cooccurence:736 coexpression:853
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 920 909 ctx cooccurence:531 coexpression:808
Rv2841c nusA transcription termination/antitermination protein NusA 910 888 coexpression:832
Rv2908c hyp hypothetical protein 885 885 ctx neighborhood:872
Rv3458c rpsD 30S ribosomal protein S4 895 881 coexpression:852
Rv0704 rplB 50S ribosomal protein L2 880 879 coexpression:861
Rv0732 secY preprotein translocase SecY 880 874 coexpression:857
Rv0716 rplE 50S ribosomal protein L5 873 874 coexpression:845
Rv2890c rpsB 30S ribosomal protein S2 901 872 coexpression:832
Rv0707 rpsC 30S ribosomal protein S3 888 872 coexpression:842
Rv0702 rplD 50S ribosomal protein L4 862 862 coexpression:861
Rv0703 rplW 50S ribosomal protein L23 858 859 coexpression:858

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tRNA (guanine-N1)-methyltransferase
  • MTBC0 PGAP product: tRNA (guanosine(37)-N1)-methyltransferase TrmD
  • Pfam (hmmscan --cut_ga): tRNA_m1G_MT PF01746.27 (E=9e-93)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217422.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA_m1G_MT (PF01746.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0336
  • Curated reference: UniProt P9WFY7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 165 functional partner(s); context anchor rimM
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003088|Rv2906c|trmD
MRIDIVTIFPACLDPLRQSLPGKAIESGLVDLNVHDLRRWTHDVHHSVDDAPYGGGPGMVMKAPVWGEALDEICSSETLLIVPTPAGVLFTQATAQRWTTESHLVFACGRYEGIDQRVVQDAARRMRVEEVSIGDYVLPGGESAAVVMVEAVLRLLAGVLGNPASHQDDSHSTGLDGLLEGPSYTRPASWRGLDVPEVLLSGDHARIAAWRREVSLQRTRERRPDLSHPD