Rv2675c Resolved · high auto-curated

H37Rv Rv2675c · MTBC0 mtbc0_002849 · 250 aa · 3013497–3014249 MTBC0 (-) · RefSeq NP_217191.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2658c (Rv2658c) — family_assigned: hypothetical protein Rv2659c (Rv2659c) — requalified: tyrosine-type recombinase/integrase Rv2659c Rv2660c (Rv2660c) — dark: hypothetical protein Rv2661c (Rv2661c) — dark: hypothetical protein Rv2662 (Rv2662) — dark: hypothetical protein Rv2663 (Rv2663) — requalified: hypothetical protein Rv2664 (Rv2664) — family_assigned: hypothetical protein Rv2665 (Rv2665) — requalified: arginine RICH protein Rv2668 (Rv2668) — family_assigned: hypothetical protein Rv2669 (Rv2669) — requalified: N-acetyltransferase zapE (Rv2670c) — requalified: cell division protein ZapE zapE ribD (Rv2671) — requalified: bifunctional diaminohydroxyphosphoribosylaminopyrimidine dea Rv2672 (Rv2672) — requalified: alpha/beta fold hydrolase Rv2672 aftC (Rv2673) — requalified: arabinofuranan 3-O-arabinosyltransferase aftC msrB (Rv2674) — requalified: peptide-methionine (R)-S-oxide reductase MsrB Rv2675c (Rv2675c) — requalified: class I SAM-dependent methyltransferase hemQ (Rv2676c) — requalified: hydrogen peroxide-dependent heme synthase hemE (Rv2678c) — requalified: uroporphyrinogen decarboxylase hemE echA15 (Rv2679) — family_assigned: enoyl-CoA hydratase/isomerase family protein echA15 Rv2680 (Rv2680) — dark: DUF3000 domain-containing protein Rv2681 (Rv2681) — requalified: ribonuclease D Rv2681 arsA (Rv2684) — family_assigned: ArsB/NhaD family transporter arsA Rv2686c (Rv2686c) — family_assigned: fluoroquinolones efflux ABC transporter permease 3 004 kb 3 008 kb 3 012 kb 3 016 kb 3 020 kb 3 024 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationclass I SAM-dependent methyltransferase
Revised (this work)Class I SAM-dependent methyltransferase. Pfam: Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

Neighbourcld (Rv2676c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.47 (95% CI -0.50 to 4.89). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2694c · 100.0% identity
M. marinum MMAR_2041 · 77.6% identity
M. orygis RJtmp_002759 · 100.0% identity
M. abscessus MAB_0240 · 46.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6Y1G8 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMethyltransferase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionThiopurine S-methyltransferase (TPMT)
Orthologous groupCOG0500

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.443 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.72% of strains (1048) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 74.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 3/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 37.2%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 14 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 14 growth-advantage. Saturation 1.000, mean read count 257.214285714. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance227.0 ppm · rank 782/3519 (77.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length250 aa
Molecular weight27.5 kDa
Theoretical pI5.65
GRAVY-0.239 (hydrophilic)
Aliphatic index76.1
Aromaticity0.1
Instability index32.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_23PF13489.13 8.7e-0743–153 Methyltransferase domain
Methyltransf_31PF13847.13 7.3e-1553–158 Methyltransferase domain
Methyltransf_25PF13649.13 1.7e-1554–149 Methyltransferase domain
Methyltransf_11PF08241.19 4.9e-1355–153 Methyltransferase domain
Methyltransf_12PF08242.19 1.9e-0755–152 Methyltransferase domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.8

PDB hitprobTM-scoreE-valueDescription
4nec-assembly4_D 1.00 0.76 2.5e-18 sig 4nec-assembly4_D Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis
4nec-assembly3_C 1.00 0.77 1.1e-17 sig 4nec-assembly3_C Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis
4nec-assembly1_A 1.00 0.73 3.7e-18 sig 4nec-assembly1_A Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis
4nec-assembly2_B 1.00 0.71 3.5e-18 sig 4nec-assembly2_B Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis
6mro-assembly1_A 1.00 0.87 4.6e-16 sig 6mro-assembly1_A Crystal structure of methyl transferase from Methanosarcina acetivorans at 1.6 Angstroms resolution, Northeast Structural Genomics Consortium (NESG) Target MvR53.

Foldseek search of the AlphaFold DB model (mean pLDDT 91.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 4

Upstream (5' on genome)msrB (+ strand, 67 bp gap)
Downstream (3' on genome)Rv2676c (- strand, -4 bp gap)
Predicted operon Rv2675c · Rv2676c · hemY · hemE

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: hemE (uroporphyrinogen decarboxylase), high confidence from genomic context alone (score 820 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2678c hemE uroporphyrinogen decarboxylase 828 820 ctx neighborhood:773
Rv2676c hemQ hyp hypothetical protein 787 786 ctx neighborhood:773
Rv2677c hemY protoporphyrinogen oxidase 786 786 ctx neighborhood:776
Rv2679 echA15 enoyl-CoA hydratase EchA15 566 566 ctx neighborhood:560
Rv2751 hyp hypothetical protein 520 521 ctx cooccurence:510
Rv3707c hyp hypothetical protein 443 444 ctx cooccurence:440
Rv2743c hyp hypothetical protein 401 401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: class I SAM-dependent methyltransferase
  • Pfam (hmmscan --cut_ga): Methyltransf_23 PF13489.13 (E=9e-07), Methyltransf_31 PF13847.13 (E=7e-15), Methyltransf_25 PF13649.13 (E=2e-15), Methyltransf_11 PF08241.19 (E=5e-13), Methyltransf_12 PF08242.19 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217191.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt I6Y1G8 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor hemE
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002849|Rv2675c|
MTAQFDPADPTRFEEMYRDDRVAHGLPAATPWDIGGPQPVVQQLVALGAIRGEVLDPGTGPGHHAIYYAAKGYAATGIDGSVAAIERARDNARKAGVSVNFQVGDATTLDGLDGRFDTVVDCAFYHTFSTAPELQRCYVRALRRASKPGARLYMFEFGEHNVNGFSMPRSLSEDDFRQVLPVGGWEITYLGTTTYQVNLSVEALELMAARNPDMADQVRCVLERFRAIKPWLVGGRVHAPFWEVHATRVD