Rv2663 Family assigned · low auto-curated · to review

H37Rv Rv2663 · MTBC0 mtbc0_002837 · 77 aa · 3004056–3004289 (+) · RefSeq NP_217179.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 7vd7-assembly1_A Toxin - Antitoxin complex from Salmonella enterica serovar Typh (prob 1.00, TM 0.66). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt I6X520 TrEMBL · unreviewed · Predicted
UniProt nameToxin

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionRibonuclease toxin, BrnT, of type II toxin-antitoxin system
Orthologous groupCOG2929

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.161 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 92.8 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7vd7-assembly1_A 1.00 0.66 3.8e-03 sig 7vd7-assembly1_A Toxin - Antitoxin complex from Salmonella enterica serovar Typhimurium
2gu3-assembly1_A 0.89 0.59 2.7e-01 2gu3-assembly1_A YpmB protein from Bacillus subtilis
3cfi-assembly3_G 0.41 0.58 1.2e+00 3cfi-assembly3_G Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
4hzb-assembly1_F 0.35 0.46 4.4e-01 4hzb-assembly1_F Crystal structure of the type VI SeMet effector-immunity complex Tae3-Tai3 from Ralstonia pickettii
4hzb-assembly1_C 0.30 0.43 4.4e-01 4hzb-assembly1_C Crystal structure of the type VI SeMet effector-immunity complex Tae3-Tai3 from Ralstonia pickettii
2oxb-assembly1_A 0.23 0.70 3.8e+00 2oxb-assembly1_A Crystal structure of a cell-wall invertase (E203Q) from Arabidopsis thaliana in complex with sucrose
8xpo-assembly1_L 0.23 0.67 4.3e+00 8xpo-assembly1_L Cryo-EM structure of Lassa virus RdRP elongation complex with the NTP form of compound HNC-1664 bound in the active site
7fhr-assembly1_A 0.21 0.56 2.4e+00 7fhr-assembly1_A Crystal Structure of a Rieske Oxygenase from Cupriavidus metallidurans

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2664 hyp hypothetical protein 971 971 ctx neighborhood:874 coexpression:780
Rv2662 hyp hypothetical protein 577 577 ctx neighborhood:572
Rv2665 hyp hypothetical protein 411 411 ctx neighborhood:407
Rv2661c hyp hypothetical protein 406 406 ctx neighborhood:403
Rv2660c hyp hypothetical protein 406 406 ctx neighborhood:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7vd7-assembly1_A Toxin - Antitoxin complex from Salmonella enterica serovar Typh (prob 1.00, E=4e-03, TM=0.66)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217179.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2929
  • Curated reference: UniProt I6X520 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 92.8, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002837|Rv2663|
MEVRASARKHGINDDAMLHAYRNALRYVELEYHGEVQLLVIGPDQTGRLLELVIPADEPPRIIHANVLRPKFYDYLR