msrB Resolved · high auto-curated

H37Rv Rv2674 · MTBC0 mtbc0_002848 · 136 aa · 3013019–3013429 (+) · RefSeq NP_217190.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peptide methionine sulfoxide reductase MsrB
MTBC0 PGAP re-annotationpeptide-methionine (R)-S-oxide reductase MsrB
Revised (this work)Peptide-methionine (R)-S-oxide reductase MsrB. Pfam: SelR (PF01641.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YA00 TrEMBL · unreviewed · Evidence at protein level
UniProt namepeptide-methionine
EC (curated) EC 1.8.4.12

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namemsrB
eggNOG descriptionPeptide-methionine (R)-S-oxide reductase
Orthologous groupCOG0229
EC number EC 1.8.4.12
KEGG orthology K07305

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SelRPF01641.27 2.2e-5017–132 SelR domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: msrA (peptide methionine sulfoxide reductase MsrA), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 999 993 ctx fusion:900 cooccurence:749 coexpression:656 textmining:885
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 768 768 ctx neighborhood:765
Rv2672 protease 748 749 ctx neighborhood:747
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 775 694 database:594
Rv3673c membrane-anchored thioredoxin-like protein 678 657 database:594
Rv1677 dsbF lipoprotein DsbF 677 656 database:594
Rv2878c mpt53 soluble secreted antigen Mpt53 674 654 database:594
Rv0526 thioredoxin 674 654 database:594
Rv0816c thiX thioredoxin ThiX 674 654 database:594
Rv2671 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase 525 526 ctx neighborhood:523
Rv1643 rplT 50S ribosomal protein L20 561 506 experimental:474
Rv3316 sdhC succinate dehydrogenase cytochrome B-556 subunit 514 491 coexpression:489
Rv3442c rpsI 30S ribosomal protein S9 489 489 experimental:474
Rv3317 sdhD succinate dehydrogenase hydrophobic membrane anchor subunit 484 485 coexpression:483
Rv0640 rplK 50S ribosomal protein L11 635 482 experimental:474

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peptide methionine sulfoxide reductase MsrB
  • MTBC0 PGAP product: peptide-methionine (R)-S-oxide reductase MsrB
  • Pfam (hmmscan --cut_ga): SelR PF01641.27 (E=2e-50)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217190.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SelR (PF01641.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0229
  • Curated reference: UniProt I6YA00 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor msrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002848|Rv2674|msrB
MTRPKLELSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHCGWPSFFDPKSSDAVTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRYCINSISLRLVPGSV