Rv2657c Family assigned · medium auto-curated

H37Rv Rv2657c · MTBC0 mtbc0_002831 · 86 aa · 3001252–3001512 MTBC0 (-) · RefSeq NP_217173.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2640c (Rv2640c) — family_assigned: Rv2640c family ArsR-like transcriptional regulator cadI (Rv2641) — requalified: cadmium-induced metalloenzyme CadI Rv2642 (Rv2642) — family_assigned: metalloregulator ArsR/SmtB family transcription factor arsC (Rv2643) — family_assigned: ACR3 family arsenite efflux transporter arsC Rv2645 (Rv2645) — family_assigned: hypothetical protein Rv2646 (Rv2646) — requalified: tyrosine-type recombinase/integrase Rv2646 Rv2650c (Rv2650c) — requalified: phage major capsid protein Rv2650c Rv2651c (Rv2651c) — family_assigned: HK97 family phage prohead protease Rv2653c (Rv2653c) — requalified: type II toxin-antitoxin system toxin Rv2654c (Rv2654c) — requalified: type II toxin-antitoxin system antitoxin Rv2655c (Rv2655c) — family_assigned: DUF3631 domain-containing protein Rv2655c Rv2656c (Rv2656c) — dark: DUF2742 domain-containing protein Rv2657c (Rv2657c) — family_assigned: helix-turn-helix domain-containing protein Rv2658c (Rv2658c) — family_assigned: hypothetical protein Rv2659c (Rv2659c) — requalified: tyrosine-type recombinase/integrase Rv2659c Rv2660c (Rv2660c) — dark: hypothetical protein Rv2661c (Rv2661c) — dark: hypothetical protein Rv2662 (Rv2662) — dark: hypothetical protein Rv2663 (Rv2663) — requalified: hypothetical protein Rv2664 (Rv2664) — family_assigned: hypothetical protein Rv2665 (Rv2665) — requalified: arginine RICH protein Rv2668 (Rv2668) — family_assigned: hypothetical protein Rv2669 (Rv2669) — requalified: N-acetyltransferase zapE (Rv2670c) — requalified: cell division protein ZapE zapE ribD (Rv2671) — requalified: bifunctional diaminohydroxyphosphoribosylaminopyrimidine dea Rv2672 (Rv2672) — requalified: alpha/beta fold hydrolase Rv2672 aftC (Rv2673) — requalified: arabinofuranan 3-O-arabinosyltransferase aftC msrB (Rv2674) — requalified: peptide-methionine (R)-S-oxide reductase MsrB 2 992 kb 2 996 kb 3 000 kb 3 004 kb 3 008 kb 3 012 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)prophage protein
MTBC0 PGAP re-annotationhelix-turn-helix domain-containing protein
Revised (this work)Helix-turn-helix domain-containing protein. Pfam: HTH_17 (PF12728.14).
Functional category (TubercuList)insertion seqs and phages

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
Evaluation of immunodominant peptides of in vivo expressed mycobacterial antigens in an ELISA-based diagnostic assay for pulmonary tuberculosis. doi:10.1007/s42770-023-00998-0 2023
Use of Rv0222-Rv2657c-Rv1509 Fusion Protein to Improve the Accuracy of an Antibody ELISA for Extra-Pulmonary Tuberculosis in Humans. doi:10.3390/pathogens10070828 2021

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder52% of residues (metapredict) · mean AlphaFold pLDDT 77.8
Disordered regions2 IDR(s), longest 27 aa [0-27, 68-86]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene

NeighbourRv2656c (Rv2656c, - strand)
Overlap4 bp, 2 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.48 (95% CI -0.37 to 1.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Curated reference (UniProt)

UniProt I6YE30 TrEMBL · unreviewed · Predicted
UniProt nameProbable PhiRv2 prophage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionDNA binding domain, excisionase family
Orthologous group2DRZR

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 26/53 (49%) · mean identity 52.8% · 1/4 closest MTBAP relatives
present in a subset of the genus (26/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

short ORF (86 aa) a shallow stratum may reflect homology-detection failure, not true youth
present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
DS10 100% L7, L6, Bovis, La4, Caprae, Canettii (98%), L4.13 (76%), L1 (64%)
198a 100% L7, L6, Bovis, La4, Caprae, Canettii (98%), L4.13 (76%), L1 (64%)
RD11 100% L7, L6, Bovis, La4, Caprae, Canettii (98%), L4.13 (76%), L1 (64%)

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 61. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) not detected

Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.

Physico-chemical properties (computed, ProtParam)

Length86 aa
Molecular weight9.5 kDa
Theoretical pI9.18
GRAVY-0.401 (hydrophilic)
Aliphatic index69.3
Aromaticity0.07
Instability index58.1 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_17PF12728.14 1.2e-0932–76 Helix-turn-helix domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 77.8

PDB hitprobTM-scoreE-valueDescription
4j2n-assembly1_A 1.00 0.91 7.5e-05 sig 4j2n-assembly1_A Crystal Structure of mycobacteriophage Pukovnik Xis

Foldseek search of the AlphaFold DB model (mean pLDDT 77.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 6

Upstream (5' on genome)Rv2656c (- strand, -4 bp gap)
Downstream (3' on genome)Rv2658c (- strand, 16 bp gap)
Predicted operon Rv2654c · Rv2655c · Rv2656c · Rv2657c · Rv2658c · Rv2659c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (6 TF) whiB5 (activates) · Rv1353c (activates) · Rv1816 (represses) · Rv1985c (activates) · Rv1990c (represses) · Rv2250c (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2655c (prophage protein), high confidence from genomic context alone (score 800 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2655c prophage protein 800 800 ctx neighborhood:798
Rv2656c prophage protein 924 787 ctx neighborhood:785 textmining:657
Rv2654c antitoxin 896 782 ctx neighborhood:781 textmining:542
Rv2658c prophage protein 877 757 ctx neighborhood:755 textmining:514
Rv2659c prophage integrase 830 742 ctx neighborhood:740
Rv2653c toxin 679 568 ctx neighborhood:567
Rv2652c prophage protein 495 495 ctx neighborhood:493
Rv2660c hyp hypothetical protein 511 464 ctx neighborhood:461
Rv2661c hyp hypothetical protein 464 464 ctx neighborhood:461
Rv1584c phage protein 464 96 textmining:432
Rv0500A DNA-binding protein 521 47 textmining:518
Rv2310 excisionase 521 47 textmining:518
Rv2355 Probable transposase; Rv2355, (MTCY98.24), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos 482 46 textmining:480
Rv1398c vapB10 antitoxin VapB10 435 46 textmining:433
Rv3461c rpmJ 50S ribosomal protein L36 434 46 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: prophage protein
  • MTBC0 PGAP product: helix-turn-helix domain-containing protein
  • Pfam (hmmscan --cut_ga): HTH_17 PF12728.14 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217173.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_17 (PF12728.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DRZR
  • Curated reference: UniProt I6YE30 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 77.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv2655c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002831|Rv2657c|
MCAFPSPSLGWTVSHETERPGMADAPPLSRRYITISEAAEYLAVTDRTVRQMIADGRLRGYRSGTRLVRLRRDEVDGAMHPFGGAA