Rv2657c Family assigned · medium auto-curated

H37Rv Rv2657c · MTBC0 mtbc0_002831 · 86 aa · 3001252–3001512 (-) · RefSeq NP_217173.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)prophage protein
MTBC0 PGAP re-annotationhelix-turn-helix domain-containing protein
Revised (this work)Helix-turn-helix domain-containing protein. Pfam: HTH_17 (PF12728.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YE30 TrEMBL · unreviewed · Predicted
UniProt nameProbable PhiRv2 prophage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionDNA binding domain, excisionase family
Orthologous group2DRZR

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_17PF12728.14 1.2e-0932–76 Helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2655c (prophage protein), high confidence from genomic context alone (score 800 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2655c prophage protein 800 800 ctx neighborhood:798
Rv2656c prophage protein 924 787 ctx neighborhood:785 textmining:657
Rv2654c antitoxin 896 782 ctx neighborhood:781 textmining:542
Rv2658c prophage protein 877 757 ctx neighborhood:755 textmining:514
Rv2659c prophage integrase 830 742 ctx neighborhood:740
Rv2653c toxin 679 568 ctx neighborhood:567
Rv2652c prophage protein 495 495 ctx neighborhood:493
Rv2660c hyp hypothetical protein 511 464 ctx neighborhood:461
Rv2661c hyp hypothetical protein 464 464 ctx neighborhood:461
Rv1584c phage protein 464 96 textmining:432
Rv0500A DNA-binding protein 521 47 textmining:518
Rv2310 excisionase 521 47 textmining:518
Rv2355 Probable transposase; Rv2355, (MTCY98.24), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos 482 46 textmining:480
Rv1398c vapB10 antitoxin VapB10 435 46 textmining:433
Rv3461c rpmJ 50S ribosomal protein L36 434 46 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: prophage protein
  • MTBC0 PGAP product: helix-turn-helix domain-containing protein
  • Pfam (hmmscan --cut_ga): HTH_17 PF12728.14 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217173.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_17 (PF12728.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DRZR
  • Curated reference: UniProt I6YE30 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv2655c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002831|Rv2657c|
MCAFPSPSLGWTVSHETERPGMADAPPLSRRYITISEAAEYLAVTDRTVRQMIADGRLRGYRSGTRLVRLRRDEVDGAMHPFGGAA