Rv2668 Family assigned · low auto-curated · to review

H37Rv Rv2668 · MTBC0 mtbc0_002842 · 173 aa · 3006936–3007457 MTBC0 (+) · RefSeq NP_217184.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2650c (Rv2650c) — requalified: phage major capsid protein Rv2650c Rv2651c (Rv2651c) — family_assigned: HK97 family phage prohead protease Rv2653c (Rv2653c) — requalified: type II toxin-antitoxin system toxin Rv2654c (Rv2654c) — requalified: type II toxin-antitoxin system antitoxin Rv2655c (Rv2655c) — family_assigned: DUF3631 domain-containing protein Rv2655c Rv2656c (Rv2656c) — dark: DUF2742 domain-containing protein Rv2657c (Rv2657c) — family_assigned: helix-turn-helix domain-containing protein Rv2658c (Rv2658c) — family_assigned: hypothetical protein Rv2659c (Rv2659c) — requalified: tyrosine-type recombinase/integrase Rv2659c Rv2660c (Rv2660c) — dark: hypothetical protein Rv2661c (Rv2661c) — dark: hypothetical protein Rv2662 (Rv2662) — dark: hypothetical protein Rv2663 (Rv2663) — requalified: hypothetical protein Rv2664 (Rv2664) — family_assigned: hypothetical protein Rv2665 (Rv2665) — requalified: arginine RICH protein Rv2668 (Rv2668) — family_assigned: hypothetical protein Rv2669 (Rv2669) — requalified: N-acetyltransferase zapE (Rv2670c) — requalified: cell division protein ZapE zapE ribD (Rv2671) — requalified: bifunctional diaminohydroxyphosphoribosylaminopyrimidine dea Rv2672 (Rv2672) — requalified: alpha/beta fold hydrolase Rv2672 aftC (Rv2673) — requalified: arabinofuranan 3-O-arabinosyltransferase aftC msrB (Rv2674) — requalified: peptide-methionine (R)-S-oxide reductase MsrB Rv2675c (Rv2675c) — requalified: class I SAM-dependent methyltransferase hemQ (Rv2676c) — requalified: hydrogen peroxide-dependent heme synthase hemE (Rv2678c) — requalified: uroporphyrinogen decarboxylase hemE echA15 (Rv2679) — family_assigned: enoyl-CoA hydratase/isomerase family protein echA15 Rv2680 (Rv2680) — dark: DUF3000 domain-containing protein Rv2681 (Rv2681) — requalified: ribonuclease D 2 996 kb 3 000 kb 3 004 kb 3 008 kb 3 012 kb 3 016 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 3cfu-assembly1_A Crystal structure of the yjhA protein from Bacillus subtilis. N (prob 1.00, TM 0.61). Structure-based, putative.
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.19 (95% CI -2.50 to 3.32). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2687 · 98.3% identity
M. marinum MMAR_2047 · 89.9% identity
M. orygis RJtmp_002752 · 98.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P71965 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible exported alanine and valine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ARUH

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.875 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacteriaceae

M. canettii dN/dS (deep-divergence selection) 1.055 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 82.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 45.5%
detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) cholesterol-required

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 82. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)
Cholesterol catabolismrequired for growth on cholesterol (Griffin 2011)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 9 of 16 independent MS datasets
Integrated abundance170.0 ppm · rank 931/3519 (73.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length173 aa
Molecular weight18.4 kDa
Theoretical pI6.71
GRAVY0.149 (hydrophobic)
Aliphatic index92.9
Aromaticity0.092
Instability index28.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.5 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3cfu-assembly1_A 1.00 0.61 2.7e-04 sig 3cfu-assembly1_A Crystal structure of the yjhA protein from Bacillus subtilis. Northeast Structural Genomics Consortium target SR562
3cfu-assembly2_B 1.00 0.66 8.0e-04 sig 3cfu-assembly2_B Crystal structure of the yjhA protein from Bacillus subtilis. Northeast Structural Genomics Consortium target SR562
5bxg-assembly1_A 1.00 0.52 8.9e-04 sig 5bxg-assembly1_A Crystal structure of an uncharacterized beta-sandwich protein (CD630_09570) from Clostridium difficile 630 at 1.90 A resolution
4les-assembly1_A 0.99 0.49 1.4e-02 4les-assembly1_A 2.2 Angstrom Crystal Structure of Conserved Hypothetical Protein from Bacillus anthracis.
3nrf-assembly1_B 0.98 0.48 1.2e-02 3nrf-assembly1_B Crystal structure of an apag protein (PA1934) from pseudomonas aeruginosa pao1 at 1.50 A resolution
4eae-assembly1_B 0.96 0.43 9.9e-03 sig 4eae-assembly1_B The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e
4eae-assembly1_A 0.95 0.41 8.9e-03 sig 4eae-assembly1_A The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e
1tza-assembly1_B 0.72 0.36 2.1e-02 1tza-assembly1_B X-ray structure of Northeast Structural Genomics Consortium target SoR45

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.6

PDB hitprobTM-scoreE-valueDescription
3cfu-assembly1_A 1.00 0.57 1.4e-03 sig 3cfu-assembly1_A Crystal structure of the yjhA protein from Bacillus subtilis. Northeast Structural Genomics Consortium target SR562
4eae-assembly1_A 0.99 0.48 4.5e-03 sig 4eae-assembly1_A The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e
5bxg-assembly1_A 0.99 0.46 5.7e-03 sig 5bxg-assembly1_A Crystal structure of an uncharacterized beta-sandwich protein (CD630_09570) from Clostridium difficile 630 at 1.90 A resolution
4eae-assembly1_B 0.91 0.37 7.5e-03 sig 4eae-assembly1_B The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e

Foldseek search of the AlphaFold DB model (mean pLDDT 87.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)clpC2 (+ strand, 78 bp gap)
Downstream (3' on genome)Rv2669 (+ strand, 28 bp gap)
Predicted operon Rv2668 · Rv2669

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) csoR (represses) · Rv1353c (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2669 (GCN5-like N-acetyltransferase), high confidence from genomic context alone (score 841 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2669 GCN5-like N-acetyltransferase 841 841 ctx neighborhood:839
Rv2667 clpC2 ATP-dependent protease ATP-binding subunit ClpC 787 787 ctx neighborhood:786
Rv2666 Probable transposase for insertion sequence element IS1081 (fragment); Required for the transposition of the insertion element. 518 518 ctx neighborhood:518

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 3cfu-assembly1_A Crystal structure of the yjhA protein from Bacillus subtilis. N (prob 1.00, E=3e-04, TM=0.61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217184.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ARUH
  • Curated reference: UniProt P71965 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.5, confident)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor Rv2669
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002842|Rv2668|
MRRWLIVLATLLVAAAGVAAANDVPRAWAGDAPIGHIGDTLRVDTGTYVADVTVSSVVPVDPPPGFGYTRSGVPVKSFPDSSVTRADVTVRAVRVPNSFILATNFSFTGVTPFADAYKPRPCDASDWLDAALGNAPQGSIVRGGVYWDAYRDPVSVVVLLDKKTGQHLAQWNL