nat Resolved · high auto-curated
H37Rv Rv3566c · MTBC0 - ·
283 aa · 4007331–4008182 (-) ·
RefSeq YP_177989.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | arylamine N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Arylamine N-acetyltransferase. Pfam: Acetyltransf_2 (PF00797.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WJI5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Arylamine N-acetyltransferase |
| EC (curated) |
EC 2.3.1.5
|
| Curated function | Catalyzes the transfer of the acetyl group from acetyl coenzyme A to the free amino group of arylamines and hydrazines. Is able to utilize not only acetyl-CoA, but also n-propionyl-CoA and acetoacetyl-CoA as acyl donors, although at a lower rate. As acetyl-CoA and propionyl-CoA are products of cholesterol catabolism and the nat gene is likely present in the same operon than genes involved in cholesterol degradation, this enzyme could have a role in the utilization and regulation of these CoA species..; FUNCTION: It has been reported that overexpression of this enzyme may be responsible for inc. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | nat |
| eggNOG description | N-acetyltransferase |
| Orthologous group | COG2162 |
| EC number |
EC 2.3.1.118, EC 2.3.1.5
|
| KEGG orthology |
K00622, K00675
|
| KEGG pathways |
map00232, map00633, map00983, map01100, map01110, map01120, map05204
|
| Gene Ontology (15) |
GO:0003674, GO:0003824, GO:0004060, GO:0005575, GO:0005623, GO:0005886, GO:0008080, GO:0016020, GO:0016407, GO:0016410, GO:0016740, GO:0016746 +3 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.722 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_2 | PF00797.24 | 1.4e-81 | 21–258 | N-acetyltransferase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hsaB (flavin-dependent monooxygenase reductase subunit HsaB), medium confidence from genomic context alone (score 607 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3566A hyp |
hypothetical protein | 938 | 939 ctx | neighborhood:781 coexpression:731 |
Rv1908c katG |
catalase-peroxidase | 912 | 901 | database:900 |
Rv3567c hsaB |
flavin-dependent monooxygenase reductase subunit HsaB | 713 | 607 ctx | neighborhood:419 |
Rv0222 echA1 |
enoyl-CoA hydratase EchA1 | 545 | 546 ctx | neighborhood:544 |
Rv3568c hsaC |
extradiol dioxygenase | 619 | 514 ctx | neighborhood:408 |
Rv1703c |
methyltransferase | 503 | 482 ctx | cooccurence:480 |
Rv3569c hsaD |
4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase | 795 | 430 | textmining:655 |
Rv1905c aao |
D-amino acid oxidase | 423 | 424 ctx | cooccurence:420 |
Rv3570c hsaA |
flavin-dependent monooxygenase oxygenase subunit HsaA | 697 | 408 | textmining:510 |
Rv2126c PE_PGRS37 |
PE-PGRS family protein PE_PGRS37 | 401 | 401 ctx | cooccurence:401 |
Rv1428c hyp |
hypothetical protein | 632 | 396 | textmining:416 |
Rv2669 |
GCN5-like N-acetyltransferase | 661 | 51 | textmining:658 |
Rv1135A |
Rv1135A, len: 80 aa. Possible acetyl-CoA acetyltransferase (possible gene fragment), highly similar to other acetyl-CoA acetyltransferases e | 402 | 50 | |
Rv1332 |
transcriptional regulator | 441 | 47 | textmining:438 |
Rv0998 |
acetyltransferase Pat | 412 | 44 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): arylamine N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_2 PF00797.24 (E=1e-81)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177989.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_2 (PF00797.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2162 - Curated reference: UniProt P9WJI5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
18 functional partner(s); context anchor
hsaB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3566c|nat MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKLVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSGGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTTQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLADAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP