nat Resolved · high auto-curated

H37Rv Rv3566c · MTBC0 - · 283 aa · 4007331–4008182 (-) · RefSeq YP_177989.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)arylamine N-acetyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Arylamine N-acetyltransferase. Pfam: Acetyltransf_2 (PF00797.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJI5 SwissProt · reviewed · Evidence at protein level
UniProt nameArylamine N-acetyltransferase
EC (curated) EC 2.3.1.5
Curated functionCatalyzes the transfer of the acetyl group from acetyl coenzyme A to the free amino group of arylamines and hydrazines. Is able to utilize not only acetyl-CoA, but also n-propionyl-CoA and acetoacetyl-CoA as acyl donors, although at a lower rate. As acetyl-CoA and propionyl-CoA are products of cholesterol catabolism and the nat gene is likely present in the same operon than genes involved in cholesterol degradation, this enzyme could have a role in the utilization and regulation of these CoA species..; FUNCTION: It has been reported that overexpression of this enzyme may be responsible for inc.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namenat
eggNOG descriptionN-acetyltransferase
Orthologous groupCOG2162
EC number EC 2.3.1.118, EC 2.3.1.5
KEGG orthology K00622, K00675
KEGG pathways map00232, map00633, map00983, map01100, map01110, map01120, map05204
Gene Ontology (15) GO:0003674, GO:0003824, GO:0004060, GO:0005575, GO:0005623, GO:0005886, GO:0008080, GO:0016020, GO:0016407, GO:0016410, GO:0016740, GO:0016746 +3 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.722 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_2PF00797.24 1.4e-8121–258 N-acetyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hsaB (flavin-dependent monooxygenase reductase subunit HsaB), medium confidence from genomic context alone (score 607 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3566A hyp hypothetical protein 938 939 ctx neighborhood:781 coexpression:731
Rv1908c katG catalase-peroxidase 912 901 database:900
Rv3567c hsaB flavin-dependent monooxygenase reductase subunit HsaB 713 607 ctx neighborhood:419
Rv0222 echA1 enoyl-CoA hydratase EchA1 545 546 ctx neighborhood:544
Rv3568c hsaC extradiol dioxygenase 619 514 ctx neighborhood:408
Rv1703c methyltransferase 503 482 ctx cooccurence:480
Rv3569c hsaD 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase 795 430 textmining:655
Rv1905c aao D-amino acid oxidase 423 424 ctx cooccurence:420
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 697 408 textmining:510
Rv2126c PE_PGRS37 PE-PGRS family protein PE_PGRS37 401 401 ctx cooccurence:401
Rv1428c hyp hypothetical protein 632 396 textmining:416
Rv2669 GCN5-like N-acetyltransferase 661 51 textmining:658
Rv1135A Rv1135A, len: 80 aa. Possible acetyl-CoA acetyltransferase (possible gene fragment), highly similar to other acetyl-CoA acetyltransferases e 402 50
Rv1332 transcriptional regulator 441 47 textmining:438
Rv0998 acetyltransferase Pat 412 44 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): arylamine N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_2 PF00797.24 (E=1e-81)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177989.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_2 (PF00797.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2162
  • Curated reference: UniProt P9WJI5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor hsaB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3566c|nat
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKLVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSGGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTTQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLADAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP