Rv2664 Family assigned · medium

H37Rv Rv2664 · MTBC0 mtbc0_002838 · 84 aa · 3004300–3004554 (+) · RefSeq NP_217180.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)DNA-binding transcriptional regulator (winged-HTH / ECF-sigma-factor-like fold), structural homolog of the mycobacterial transcription factor Rv2667/CymA (ClpC2/CymA system) RefSeq leaves this locus uncharacterised.

Curated reference (UniProt)

UniProt I6Y9Z5 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EIKQ

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.328 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.9 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8dtq-assembly1_B 0.16 0.64 5.0e+00 8dtq-assembly1_B Crystal Structure of Staphylococcus aureus pSK41 Cop
7tz1-assembly1_A 0.14 0.49 2.4e+00 7tz1-assembly1_A Crystal Structure of a Mycobacteriophage Cluster A2 Immunity Repressor:DNA Complex
6vmh-assembly1_C 0.13 0.57 4.7e+00 6vmh-assembly1_C Crystal structure of transcriptional regulator from bacteriophage 186
8b4h-assembly1_D 0.12 0.65 9.1e+00 8b4h-assembly1_D IstA transposase cleaved donor complex
3ikt-assembly1_A 0.04 0.38 8.6e+00 3ikt-assembly1_A Crystal structure of a Rex-family repressor/DNA/NAD+ complex from Thermus aquaticus
7pan-assembly1_p 0.04 0.31 6.2e+00 7pan-assembly1_p 70S ribosome with A/P- and P/E-site tRNAs in Mycoplasma pneumoniae cells
7nrd-assembly1_Sh 0.04 0.32 9.1e+00 7nrd-assembly1_Sh Structure of the yeast Gcn1 bound to a colliding stalled 80S ribosome with MBF1, A/P-tRNA and P/E-tRNA

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2663 hyp hypothetical protein 971 971 ctx neighborhood:874 coexpression:780
Rv2662 hyp hypothetical protein 564 564 ctx neighborhood:558
Rv2665 hyp hypothetical protein 418 418 ctx neighborhood:414
Rv2661c hyp hypothetical protein 400 400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred: top hit 8ADA Rv2667 CymA DNA-binding TF 99.05%, E 3.9e-9, 64 cols; corroborated by ECF sigma factor, SpoIIID, sigma-H, TrfB HTH repressor (all ~95%)
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217180.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EIKQ
  • Curated reference: UniProt I6Y9Z5 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.9, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002838|Rv2664|
MKHKTDIDEWLDTIEPNPADAHDASHLRRIIAAKEAVQTAESELRAAVNAARAAGDTWAAIGVALGITRQAAFQRFGPHSTASP