hemE Resolved · high auto-curated
H37Rv Rv2678c · MTBC0 mtbc0_002852 ·
357 aa ·
3016302–3017375 MTBC0
(-) ·
RefSeq NP_217194.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | uroporphyrinogen decarboxylase |
|---|---|
| MTBC0 PGAP re-annotation | uroporphyrinogen decarboxylase |
| Revised (this work) | Uroporphyrinogen decarboxylase. Pfam: URO-D (PF01208.24). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 459 publications
459 TB publications mention this gene. 459 publication(s) discuss this gene (392 in a M. tuberculosis context, 55 in other mycobacteria — M. smegmatis (21), M. abscessus (9), M. marinum (6), M. leprae (5)).
| Publication | Date |
|---|---|
| Quercetin improves ESAT-6-induced pleural mesothelial cell fibrosis by activating the Nrf2/HO-1 pathway. doi:10.22038/ijbms.2026.86824.18778 | 2026 |
| Rv3839-Rv3840 links the endogenous heme biosynthesis pathway with Mycobacterium tuberculosis adaptation to nitric oxide and iron limitation stress. doi:10.1371/journal.pgen.1012202 | 2026 |
| Supporting activities of cognate redox partners for sterol-metabolizing P450 enzymes in Mycobacterium neoaurum. doi:10.1016/j.jbc.2026.113116 | 2026 |
| Immunoblot-based activity assay for heme-containing histidine kinases. doi:10.1007/s00775-026-02145-0 | 2026 |
| Inhibitors of cytochrome c biogenesis pathways. doi:10.1128/mbio.00273-26 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | hemG (Rv2677c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -9.29 (95% CI -9.98 to -8.59). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in porphyrin biosynthesis [catalytic activity: uroporphyrinogen III = coproporphyrinogen + 4 CO(2)]. |
|---|---|
| Mycobrowser EC |
4.1.1.37
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2697c
· 99.7% identity |
|---|---|
| M. leprae |
ML1043
· 83.8% identity |
| M. marinum |
MMAR_2038
· 85.7% identity |
| M. smegmatis |
MSMEG_2780
· 72.5% identity |
| M. orygis |
RJtmp_002762
· 100.0% identity |
| M. abscessus |
MAB_2986c
· 70.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFE1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uroporphyrinogen decarboxylase |
| EC (curated) |
EC 4.1.1.37
|
| Curated function | Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | hemE |
| eggNOG description | Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III |
| Orthologous group | COG0407 |
| EC number |
EC 4.1.1.37
|
| KEGG orthology |
K01599
|
| KEGG pathways |
map00860, map01100, map01110
|
| KEGG modules |
M00121
|
| Gene Ontology (43) |
GO:0003674, GO:0003824, GO:0004853, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006725, GO:0006778, GO:0006779, GO:0006783 +31 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.242 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 55.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 17 in the ORF — 16 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.059, mean read count 13. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | hemE-TetOn 6.1 (TetON promoter 6) |
|---|---|
| Baseline knockdown fitness | 1.529 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - slow growth (less than 1 doubling in a screening wave)) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 61.5 ppm · rank 1622/3519 (53.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 357 aa |
|---|---|
| Molecular weight | 37.6 kDa |
| Theoretical pI | 5.43 |
| GRAVY | 0.318 (hydrophobic) |
| Aliphatic index | 105.3 |
| Aromaticity | 0.062 |
| Instability index | 39.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
URO-D | PF01208.24 | 9.7e-121 | 8–356 | Uroporphyrinogen decarboxylase (URO-D) |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2inf-assembly1_A |
1.00 | 0.93 | 2.4e-33 sig | 2inf-assembly1_A Crystal Structure of Uroporphyrinogen Decarboxylase from Bacillus subtilis |
6w2o-assembly1_A |
1.00 | 0.92 | 3.6e-33 sig | 6w2o-assembly1_A Crystal structure of uroporphyrinogen III decarboxylate (hemE) from Stenotrophomonas maltophilia |
4zr8-assembly1_A |
1.00 | 0.90 | 2.5e-32 sig | 4zr8-assembly1_A Structure of uroporphyrinogen decarboxylase from Acinetobacter baumannii |
1r3q-assembly1_A |
1.00 | 0.90 | 1.8e-31 sig | 1r3q-assembly1_A Uroporphyrinogen Decarboxylase in complex with coproporphyrinogen-I |
4zr8-assembly1_B |
1.00 | 0.89 | 8.7e-32 sig | 4zr8-assembly1_B Structure of uroporphyrinogen decarboxylase from Acinetobacter baumannii |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | hemY (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | echA15 (+ strand, 52 bp gap) |
| Predicted operon |
Rv2675c · Rv2676c · hemY · hemE
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hemY (protoporphyrinogen oxidase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2677c hemY exp |
protoporphyrinogen oxidase | 999 | 1000 ctx | neighborhood:881 cooccurence:756 coexpression:916 database:900 textmining:535 |
Rv0510 hemC |
porphobilinogen deaminase | 981 | 974 ctx | fusion:776 cooccurence:553 coexpression:668 |
Rv1485 hemZ |
ferrochelatase | 989 | 952 ctx | cooccurence:764 coexpression:773 textmining:788 |
Rv0511 hemD exp |
uroporphyrin-III C-methyltransferase | 956 | 928 | database:900 textmining:418 |
Rv2676c hemQ hyp |
hypothetical protein | 927 | 924 ctx | neighborhood:881 |
Rv2847c cysG exp |
multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase | 957 | 920 | database:900 textmining:487 |
Rv0260c exp |
transcriptional regulator | 945 | 912 | database:900 textmining:412 |
Rv2675c hyp |
hypothetical protein | 828 | 820 ctx | neighborhood:773 |
Rv2679 echA15 |
enoyl-CoA hydratase EchA15 | 792 | 793 ctx | neighborhood:788 |
Rv0512 hemB |
delta-aminolevulinic acid dehydratase | 860 | 772 ctx | cooccurence:535 textmining:416 |
Rv2680 hyp |
hypothetical protein | 698 | 698 ctx | neighborhood:694 |
Rv2681 hyp |
hypothetical protein | 697 | 697 ctx | neighborhood:694 |
Rv0524 hemL |
glutamate-1-semialdehyde 2,1-aminomutase | 886 | 624 ctx | cooccurence:421 textmining:709 |
Rv0509 hemA |
glutamyl-tRNA reductase | 853 | 617 ctx | cooccurence:446 textmining:633 |
Rv2388c hemN exp |
oxygen-independent coproporphyrinogen III oxidase | 661 | 558 | database:500 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: uroporphyrinogen decarboxylase
- MTBC0 PGAP product: uroporphyrinogen decarboxylase
- Pfam (hmmscan --cut_ga): URO-D PF01208.24 (E=1e-120)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217194.1)
- Domains: Pfam-A via hmmscan --cut_ga — URO-D (PF01208.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0407 - Curated reference: UniProt P9WFE1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
47 functional partner(s); context anchor
hemY - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002852|Rv2678c|hemE MSTRRDLPQSPYLAAVTGRKPSRVPVWFMRQAGRSLPEYRALRERYSMLAACFEPDVACEITLQPIRRYDVDAAILFSDIVVPLRAAGVDLDIVADVGPVIADPVRTAADVAAMKPLDPQAIQPVLVAASLLVAELGDVPLIGFAGAPFTLASYLVEGGPSRHHAHVKAMMLAEPASWHALMAKLTDLTIAFLVGQIDAGVDAIQVFDSWAGALSPIDYRQYVLPHSARVFAALGEHGVPMTHFGVGTAELLGAMSEAVTAGERPGRGAVVGVDWRTPLTDAAARVVPGTALQGNLDPAVVLAGWPAVERAARAVVDDGRRAVDAGAAGHIFNLGHGVLPESDPAVLADLVSLVHSL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hemE? Email the maintainer — the message is pre-filled with this gene's details.