Rv0918 Family assigned · medium auto-curated
H37Rv Rv0918 · MTBC0 mtbc0_000975 ·
158 aa · 1027426–1027902 (+) ·
RefSeq NP_215433.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF1778 domain-containing protein |
| Revised (this work) | DUF1778 domain-containing protein. Pfam: TacA1 (PF08681.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05910
SwissProt · reviewed
· Evidence at transcript level
|
|---|---|
| UniProt name | Antitoxin TacA |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Counteracts the toxic effect of cognate toxin TacT..; FUNCTION: TacA-TacT both represses and derepresses expression of its own operon. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF1778) |
| Orthologous group | COG4453 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.821 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.64% of strains (933) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TacA1 | PF08681.19 | 5.0e-26 | 74–150 | Antitoxin TacA 1-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0919 (GCN5-like N-acetyltransferase), high confidence from genomic context alone (score 973 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0919 |
GCN5-like N-acetyltransferase | 973 | 973 ctx | neighborhood:801 cooccurence:767 experimental:451 |
Rv0240 vapC24 |
ribonuclease VapC24 | 682 | 682 ctx | cooccurence:681 |
Rv2775 |
GCN5-like N-acetyltransferase | 615 | 613 | experimental:451 |
Rv1525 wbbL2 |
rhamnosyl transferase WbbL | 510 | 511 ctx | cooccurence:510 |
Rv0133 |
GCN5-like N-acetyltransferase | 478 | 479 | experimental:449 |
Rv2170 |
GCN5-like N-acetyltransferase | 474 | 472 | experimental:451 |
Rv2669 |
GCN5-like N-acetyltransferase | 472 | 470 | experimental:451 |
Rv0355c PPE8 |
PPE family protein PPE8 | 470 | 470 ctx | cooccurence:467 |
Rv3420c rimI |
ribosomal-protein-alanine acetyltransferase RimI | 470 | 468 | experimental:451 |
Rv0428c |
GCN5-like N-acetyltransferase | 470 | 468 | experimental:451 |
Rv0819 mshD |
mycothiol acetyltransferase | 470 | 468 | experimental:451 |
Rv0304c PPE5 |
PPE family protein PPE5 | 468 | 468 ctx | cooccurence:465 |
Rv3347c PPE55 |
PPE family protein PPE55 | 465 | 465 ctx | cooccurence:462 |
Rv3350c PPE56 |
PPE family protein PPE56 | 463 | 464 ctx | cooccurence:462 |
Rv2949c |
chorismate pyruvate-lyase | 456 | 456 ctx | cooccurence:455 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF1778 domain-containing protein
- Pfam (hmmscan --cut_ga): TacA1 PF08681.19 (E=5e-26)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215433.1)
- Domains: Pfam-A via hmmscan --cut_ga — TacA1 (PF08681.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4453 - Curated reference: UniProt O05910 (SwissProt, reviewed; Evidence at transcript level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
47 functional partner(s); context anchor
Rv0919 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000975|Rv0918| MHRAGAAVTANVWCRAGGIRMAPRPVIPVATQQRLRRQADRQSLGGSGLPALNCTPIRHTIDVMATKPERKTERLAARLTPEQDALIRRAAEAEGTDLTNFTVTAALAHARDVLADRRLFVLTDAAWTEFLAALDRPVSHKPRLEKLFAARSIFDTEG