Rv3027c Family assigned · medium auto-curated
H37Rv Rv3027c · MTBC0 mtbc0_003218 ·
281 aa · 3407384–3408229 (-) ·
RefSeq NP_217543.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | GNAT family N-acetyltransferase |
| Revised (this work) | GNAT family N-acetyltransferase. Pfam: Acetyltransf_5 (PF13444.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YEZ8
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | GCN5-related N-acetyltransferase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Acetyltransferase (GNAT) domain |
| Orthologous group | COG3176 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.202 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 9 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_5 | PF13444.13 | 8.1e-31 | 43–145 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: trmU (tRNA-specific 2-thiouridylase), high confidence from genomic context alone (score 776 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3026c hyp |
hypothetical protein | 985 | 976 ctx | neighborhood:882 cooccurence:773 textmining:424 |
Rv3024c trmU |
tRNA-specific 2-thiouridylase | 776 | 776 ctx | neighborhood:775 |
Rv3025c iscS |
cysteine desulfurase | 776 | 776 ctx | neighborhood:775 |
Rv3028c fixB |
electron transfer flavoprotein subunit alpha | 751 | 751 ctx | neighborhood:749 |
Rv3029c fixA |
electron transfer flavoprotein subunit beta | 574 | 574 ctx | neighborhood:570 |
Rv0390 hyp |
hypothetical protein | 436 | 436 ctx | cooccurence:436 |
Rv1819c bacA |
vitamin B12 transport ATP-binding protein BacA | 428 | 428 ctx | cooccurence:426 |
Rv0436c pssA |
CDP-diacylglycerol--serine O-phosphatidyltransferase | 419 | 382 | |
Rv0651 rplJ |
50S ribosomal protein L10 | 459 | 177 | |
Rv0250c hyp |
hypothetical protein | 503 | 155 | textmining:436 |
Rv2669 |
GCN5-like N-acetyltransferase | 752 | 81 | textmining:742 |
Rv0053 rpsF |
30S ribosomal protein S6 | 443 | 55 | textmining:435 |
Rv3628 ppa |
inorganic pyrophosphatase | 514 | 47 | textmining:511 |
Rv2631 rtcB |
RNA-splicing ligase RtcB | 518 | 46 | textmining:516 |
Rv0055 rpsR1 |
30S ribosomal protein S18 | 435 | 44 | textmining:434 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: GNAT family N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_5 PF13444.13 (E=8e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217543.2)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_5 (PF13444.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3176 - Curated reference: UniProt I6YEZ8 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
trmU - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003218|Rv3027c| MSIASVLIPSDKPHGVATGSSTGPRYSLLLSTDPSMVEAAQRLRYDVFSTTPGFALPAAADTRRDGDRFDEYCDHLLVRDDDTGELVGCYRMLAPAGAIAAGGLYTATEFDVCAFDPLRPSLVEMGRAVVREGHRNGGVVLLMWAGILAYLDRYGYDYVTGCVSVPIGGDGETPGSRLRGVRDFILNRHAAPPQCQVYPYRPVRVDGRSLDDILPPPRPAVPPLMRGYLRLGARACGEPAHDPDFGVGDFCLLLDKDHADTRYLRRLRSVAAASEMVNDAR