Rv2650c Resolved · high auto-curated
H37Rv Rv2650c · MTBC0 mtbc0_002824 ·
479 aa · 2995998–2997437 (-) ·
RefSeq NP_217166.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | prophage protein |
|---|---|
| MTBC0 PGAP re-annotation | phage major capsid protein |
| Revised (this work) | Phage major capsid protein. Pfam: Phage_capsid (PF05065.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71947
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible PhiRv2 prophage protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Phage capsid family |
| Orthologous group | COG4653 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.2 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 4 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (224) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Phage_capsid | PF05065.20 | 1.0e-53 | 196–474 | Phage capsid family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2651c (prophage protease), high confidence from genomic context alone (score 988 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2651c |
prophage protease | 989 | 988 ctx | neighborhood:787 cooccurence:686 coexpression:838 |
Rv1577c |
phage prohead protease | 955 | 952 ctx | cooccurence:693 coexpression:839 |
Rv1576c |
phage capsid protein | 842 | 842 | coexpression:841 |
Rv0355c PPE8 |
PPE family protein PPE8 | 650 | 651 ctx | cooccurence:647 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 646 | 646 ctx | cooccurence:640 |
Rv3347c PPE55 |
PPE family protein PPE55 | 640 | 640 ctx | cooccurence:635 |
Rv3350c PPE56 |
PPE family protein PPE56 | 636 | 636 ctx | cooccurence:632 |
Rv1917c PPE34 |
PPE family protein PPE34 | 634 | 635 ctx | cooccurence:633 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 633 | 633 ctx | cooccurence:627 |
Rv2209 |
integral membrane protein | 628 | 629 ctx | cooccurence:623 |
Rv1004c |
membrane protein | 627 | 627 ctx | cooccurence:625 |
Rv0304c PPE5 |
PPE family protein PPE5 | 626 | 627 ctx | cooccurence:623 |
Rv0977 PE_PGRS16 |
PE-PGRS family protein PE_PGRS16 | 615 | 616 ctx | cooccurence:422 |
Rv3343c PPE54 |
PPE family protein PPE54 | 596 | 597 ctx | cooccurence:594 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 593 | 594 ctx | cooccurence:587 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: prophage protein
- MTBC0 PGAP product: phage major capsid protein
- Pfam (hmmscan --cut_ga): Phage_capsid PF05065.20 (E=1e-53)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217166.1)
- Domains: Pfam-A via hmmscan --cut_ga — Phage_capsid (PF05065.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4653 - Curated reference: UniProt P71947 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
71 functional partner(s); context anchor
Rv2651c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002824|Rv2650c| MTTEQHFADDGDIKQLSLDETRSAAKQLLDSVEGDLTGDVAQRFQALTRHAEELRAEQRRRGREAEEALRRCRAGELRVVPGAPTGGDDGDAPPGNSLRDTAFRTLDVCVRDGLMSSRAAEAAETLCRTGPPQSTSWAQRWLAATGNRDYLGAFVKRVSNPVAGHTTWTDREAAAWREAAAVAAEQRAMGLVDTAGGFLIPAALDPAILLSGDGSTNPIRQVARVVQTTSEVWRGVTSEGAEAHWYSEAQEVSDDSPTLAQPAVPSYRGSCWIPFSLEIEGDAAGFVAEVGRVLADSVEQLQAAAFVSGSGNGEPTGFVSALTGTADYTVTGAGTEAVVAADVYALQSALPPRFQSNSAFAANLSTINVLRQAETANGALKFPSLHASPPMLAGKHIWEVSNMDTVDAAVTATNYPLVLGDWKQFIITDRVGSTVELVPHVFGGNRRPTGQRGFFCWFRVGSDVLVDNAFRVLKVQTTA