Rv2650c Resolved · high auto-curated
H37Rv Rv2650c · MTBC0 mtbc0_002824 ·
479 aa ·
2995998–2997437 MTBC0
(-) ·
RefSeq NP_217166.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | prophage protein |
|---|---|
| MTBC0 PGAP re-annotation | phage major capsid protein |
| Revised (this work) | Phage major capsid protein. Pfam: Phage_capsid (PF05065.20). |
| Functional category (TubercuList) | insertion seqs and phages |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Prophage Gene Rv2650c Enhances Intracellular Survival of Mycobacterium smegmatis. doi:10.3389/fmicb.2021.819837 | 2021 |
| Novel polyprotein antigens designed for improved serodiagnosis of bovine tuberculosis. doi:10.1016/j.vetimm.2021.110320 | 2021 |
| Distribution and function of prophage phiRv1 and phiRv2 among Mycobacterium tuberculosis complex. doi:10.1080/07391102.2015.1022602 | 2016 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.00 (95% CI -0.10 to 0.10). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Curated reference (UniProt)
| UniProt |
P71947
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible PhiRv2 prophage protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Phage capsid family |
| Orthologous group | COG4653 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.2 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 4 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (224) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 14/53 (26%) · mean identity 52.5%
· 2/4 closest MTBAP relatives present in a subset of the genus (14/53 NTM; in 2 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Regions of Difference (lineage deletions)
| RD | Gene overlap | Deleted in lineages |
|---|---|---|
DS10 |
100% | L7, L6, Bovis, La4, Caprae, Canettii (98%), L4.13 (76%), L1 (64%) |
198a |
100% | L7, L6, Bovis, La4, Caprae, Canettii (98%), L4.13 (76%), L1 (64%) |
RD11 |
100% | L7, L6, Bovis, La4, Caprae, Canettii (98%), L4.13 (76%), L1 (64%) |
This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.
Essentiality (transposon mutagenesis) GD — not strictly essential
| DeJesus 2017 call | GD · growth-defect |
|---|---|
| What the call means | growth-defect: insertions tolerated but fitness reduced; NOT essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 10 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.900, mean read count 5.33333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | `essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 11.2 ppm · rank 2631/3519 (25.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 479 aa |
|---|---|
| Molecular weight | 51.1 kDa |
| Theoretical pI | 4.99 |
| GRAVY | -0.21 (hydrophilic) |
| Aliphatic index | 78.1 |
| Aromaticity | 0.071 |
| Instability index | 37.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Phage_capsid | PF05065.20 | 1.0e-53 | 196–474 | Phage capsid family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 80.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6tsu-assembly1_U4 |
1.00 | 0.79 | 1.1e-18 sig | 6tsu-assembly1_U4 Capsid of empty GTA particle computed with C5 symmetry |
6tb9-assembly1_C5 |
1.00 | 0.78 | 7.2e-19 sig | 6tb9-assembly1_C5 Capsid of native GTA particle computed with C5 symmetry |
6tsu-assembly1_B5 |
1.00 | 0.75 | 2.8e-18 sig | 6tsu-assembly1_B5 Capsid of empty GTA particle computed with C5 symmetry |
6tb9-assembly1_B5 |
1.00 | 0.72 | 1.1e-16 sig | 6tb9-assembly1_B5 Capsid of native GTA particle computed with C5 symmetry |
8edu-assembly1_G |
1.00 | 0.66 | 2.1e-13 sig | 8edu-assembly1_G Mycobacteriophage Muddy capsid |
Foldseek search of the AlphaFold DB model (mean pLDDT 80.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2647 (+ strand, 1767 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2651c (- strand, 7 bp gap) |
| Predicted operon |
Rv2650c · Rv2651c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv2034 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2651c (prophage protease), high confidence from genomic context alone (score 988 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2651c |
prophage protease | 989 | 988 ctx | neighborhood:787 cooccurence:686 coexpression:838 |
Rv1577c |
phage prohead protease | 955 | 952 ctx | cooccurence:693 coexpression:839 |
Rv1576c |
phage capsid protein | 842 | 842 | coexpression:841 |
Rv0355c PPE8 |
PPE family protein PPE8 | 650 | 651 ctx | cooccurence:647 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 646 | 646 ctx | cooccurence:640 |
Rv3347c PPE55 |
PPE family protein PPE55 | 640 | 640 ctx | cooccurence:635 |
Rv3350c PPE56 |
PPE family protein PPE56 | 636 | 636 ctx | cooccurence:632 |
Rv1917c PPE34 |
PPE family protein PPE34 | 634 | 635 ctx | cooccurence:633 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 633 | 633 ctx | cooccurence:627 |
Rv2209 |
integral membrane protein | 628 | 629 ctx | cooccurence:623 |
Rv1004c |
membrane protein | 627 | 627 ctx | cooccurence:625 |
Rv0304c PPE5 |
PPE family protein PPE5 | 626 | 627 ctx | cooccurence:623 |
Rv0977 PE_PGRS16 |
PE-PGRS family protein PE_PGRS16 | 615 | 616 ctx | cooccurence:422 |
Rv3343c PPE54 |
PPE family protein PPE54 | 596 | 597 ctx | cooccurence:594 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 593 | 594 ctx | cooccurence:587 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: prophage protein
- MTBC0 PGAP product: phage major capsid protein
- Pfam (hmmscan --cut_ga): Phage_capsid PF05065.20 (E=1e-53)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217166.1)
- Domains: Pfam-A via hmmscan --cut_ga — Phage_capsid (PF05065.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4653 - Curated reference: UniProt P71947 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 80.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
71 functional partner(s); context anchor
Rv2651c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002824|Rv2650c| MTTEQHFADDGDIKQLSLDETRSAAKQLLDSVEGDLTGDVAQRFQALTRHAEELRAEQRRRGREAEEALRRCRAGELRVVPGAPTGGDDGDAPPGNSLRDTAFRTLDVCVRDGLMSSRAAEAAETLCRTGPPQSTSWAQRWLAATGNRDYLGAFVKRVSNPVAGHTTWTDREAAAWREAAAVAAEQRAMGLVDTAGGFLIPAALDPAILLSGDGSTNPIRQVARVVQTTSEVWRGVTSEGAEAHWYSEAQEVSDDSPTLAQPAVPSYRGSCWIPFSLEIEGDAAGFVAEVGRVLADSVEQLQAAAFVSGSGNGEPTGFVSALTGTADYTVTGAGTEAVVAADVYALQSALPPRFQSNSAFAANLSTINVLRQAETANGALKFPSLHASPPMLAGKHIWEVSNMDTVDAAVTATNYPLVLGDWKQFIITDRVGSTVELVPHVFGGNRRPTGQRGFFCWFRVGSDVLVDNAFRVLKVQTTA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2650c? Email the maintainer — the message is pre-filled with this gene's details.