Rv2650c Resolved · high auto-curated

H37Rv Rv2650c · MTBC0 mtbc0_002824 · 479 aa · 2995998–2997437 (-) · RefSeq NP_217166.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)prophage protein
MTBC0 PGAP re-annotationphage major capsid protein
Revised (this work)Phage major capsid protein. Pfam: Phage_capsid (PF05065.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71947 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible PhiRv2 prophage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPhage capsid family
Orthologous groupCOG4653

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.2 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (224) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Phage_capsidPF05065.20 1.0e-53196–474 Phage capsid family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2651c (prophage protease), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2651c prophage protease 989 988 ctx neighborhood:787 cooccurence:686 coexpression:838
Rv1577c phage prohead protease 955 952 ctx cooccurence:693 coexpression:839
Rv1576c phage capsid protein 842 842 coexpression:841
Rv0355c PPE8 PPE family protein PPE8 650 651 ctx cooccurence:647
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 646 646 ctx cooccurence:640
Rv3347c PPE55 PPE family protein PPE55 640 640 ctx cooccurence:635
Rv3350c PPE56 PPE family protein PPE56 636 636 ctx cooccurence:632
Rv1917c PPE34 PPE family protein PPE34 634 635 ctx cooccurence:633
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 633 633 ctx cooccurence:627
Rv2209 integral membrane protein 628 629 ctx cooccurence:623
Rv1004c membrane protein 627 627 ctx cooccurence:625
Rv0304c PPE5 PPE family protein PPE5 626 627 ctx cooccurence:623
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 615 616 ctx cooccurence:422
Rv3343c PPE54 PPE family protein PPE54 596 597 ctx cooccurence:594
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 593 594 ctx cooccurence:587

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: prophage protein
  • MTBC0 PGAP product: phage major capsid protein
  • Pfam (hmmscan --cut_ga): Phage_capsid PF05065.20 (E=1e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217166.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Phage_capsid (PF05065.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4653
  • Curated reference: UniProt P71947 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 71 functional partner(s); context anchor Rv2651c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002824|Rv2650c|
MTTEQHFADDGDIKQLSLDETRSAAKQLLDSVEGDLTGDVAQRFQALTRHAEELRAEQRRRGREAEEALRRCRAGELRVVPGAPTGGDDGDAPPGNSLRDTAFRTLDVCVRDGLMSSRAAEAAETLCRTGPPQSTSWAQRWLAATGNRDYLGAFVKRVSNPVAGHTTWTDREAAAWREAAAVAAEQRAMGLVDTAGGFLIPAALDPAILLSGDGSTNPIRQVARVVQTTSEVWRGVTSEGAEAHWYSEAQEVSDDSPTLAQPAVPSYRGSCWIPFSLEIEGDAAGFVAEVGRVLADSVEQLQAAAFVSGSGNGEPTGFVSALTGTADYTVTGAGTEAVVAADVYALQSALPPRFQSNSAFAANLSTINVLRQAETANGALKFPSLHASPPMLAGKHIWEVSNMDTVDAAVTATNYPLVLGDWKQFIITDRVGSTVELVPHVFGGNRRPTGQRGFFCWFRVGSDVLVDNAFRVLKVQTTA