tsaB Family assigned · medium auto-curated
H37Rv Rv3421c · MTBC0 mtbc0_003635 ·
211 aa ·
3864498–3865133 MTBC0
(-) ·
RefSeq NP_217938.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB |
| Revised (this work) | TRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB. Pfam: TsaD (PF00814.32). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Phenotype-driven functional lead (hypothesis) priority 5.0
disruption confers tolerance to Ethambutol; disruption advantageous in vivo (growth-restraining in the host); altered fitness on cholesterol (lipid catabolism).
| Corroborating evidence | conserved / under constraint intra-MTBC; STRING-coupled to tsaE (tRNA threonylcarbamoyladenosine biosynthesis protein); co-transcribed with gcp, rimI, alr; structural lead available |
|---|
This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | rimI (Rv3420c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -3.04 (95% CI -4.23 to -1.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3455c
· 100.0% identity |
|---|---|
| M. leprae |
ML0378
· 76.0% identity |
| M. marinum |
MMAR_1122
· 81.2% identity |
| M. smegmatis |
MSMEG_1578
· 71.0% identity |
| M. orygis |
RJtmp_003523
· 100.0% identity |
| M. abscessus |
MAB_3736c
· 60.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKY7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv3421c |
UniProt still lists this protein as Uncharacterized protein Rv3421c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | yeaZ |
| eggNOG description | Peptidase M22, glycoprotease |
| Orthologous group | COG1214 |
| KEGG orthology |
K14742
|
| Gene Ontology (32) |
GO:0002949, GO:0005575, GO:0005618, GO:0005623, GO:0006139, GO:0006396, GO:0006399, GO:0006400, GO:0006725, GO:0006807, GO:0008033, GO:0008150 +20 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.389 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.195 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 78.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 50.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) cholesterol-required
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 21.6363636364. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Cholesterol catabolism | required for growth on cholesterol (Griffin 2011) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness on cholesterol (vs glycerol) (carbon source) | -4.64 | 0.014 | required |
| fitness in mouse infection (in vivo) | +2.74 | 0.045 | disruption advantageous |
| altered fitness under Ethambutol (drug exposure) | +2.72 | 0.013 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.60 | 0.04 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) | +2.29 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +2.28 | 0.044 | required |
| fitness in mouse infection (in vivo) | +2.06 | 0.0053 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +2.05 | 0.023 | required |
| fitness in mouse infection (in vivo) | +1.79 | 0.032 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.65 | 0.024 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.58 | 0.034 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 11 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 3.65 ppm · rank 3042/3519 (13.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 211 aa |
|---|---|
| Molecular weight | 21.6 kDa |
| Theoretical pI | 6.05 |
| GRAVY | 0.398 (hydrophobic) |
| Aliphatic index | 105.1 |
| Aromaticity | 0.043 |
| Instability index | 32.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TsaD | PF00814.32 | 3.2e-26 | 40–147 | tRNA N6-adenosine threonylcarbamoyltransferase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5br9-assembly3_E |
1.00 | 0.76 | 3.5e-14 sig | 5br9-assembly3_E Crystal structure of an uncharacterized protein with similarity to peptidase YEAZ from Pseudomonas aeruginosa |
4y0w-assembly1_B-2 |
1.00 | 0.76 | 2.7e-13 sig | 4y0w-assembly1_B-2 YeaZ from Pseudomonas aeruginosa |
4y0w-assembly1_C-2 |
1.00 | 0.74 | 6.4e-13 sig | 4y0w-assembly1_C-2 YeaZ from Pseudomonas aeruginosa |
4y0w-assembly1_D-2 |
1.00 | 0.75 | 1.5e-12 sig | 4y0w-assembly1_D-2 YeaZ from Pseudomonas aeruginosa |
3zeu-assembly2_A |
1.00 | 0.76 | 6.3e-12 sig | 3zeu-assembly2_A Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer bound to ATPgammaS |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | rimI (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3422c (- strand, -4 bp gap) |
| Predicted operon |
gcp · rimI · Rv3421c · Rv3422c · alr
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
trcR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: tsaE (tRNA threonylcarbamoyladenosine biosynthesis protein), high confidence from genomic context alone (score 996 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3422c tsaE exp |
tRNA threonylcarbamoyladenosine biosynthesis protein | 999 | 996 ctx | neighborhood:881 coexpression:777 experimental:803 textmining:895 |
Rv3419c gcp exp |
O-sialoglycoprotein endopeptidase | 999 | 996 ctx | neighborhood:882 coexpression:546 experimental:922 textmining:895 |
Rv3420c rimI |
ribosomal-protein-alanine acetyltransferase RimI | 996 | 974 ctx | neighborhood:882 fusion:634 textmining:878 |
Rv3423c alr |
alanine racemase | 955 | 906 ctx | neighborhood:881 textmining:548 |
Rv3279c birA |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 617 | 618 | coexpression:503 |
Rv3433c nnr |
bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | 550 | 551 ctx | neighborhood:544 |
Rv3432c gadB |
glutamate decarboxylase GadB | 544 | 544 ctx | neighborhood:544 |
Rv1259 udgB |
uracil DNA glycosylase | 540 | 541 | coexpression:503 |
Rv3418c groES |
chaperonin GroES | 761 | 533 ctx | neighborhood:531 textmining:511 |
Rv0949 uvrD1 |
ATP-dependent DNA helicase UvrD | 490 | 491 | coexpression:403 |
Rv2977c thiL |
thiamine-monophosphate kinase | 465 | 465 | coexpression:421 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 463 | 463 | |
Rv0819 mshD |
mycothiol acetyltransferase | 486 | 453 | |
Rv2170 |
GCN5-like N-acetyltransferase | 481 | 449 | |
Rv0428c |
GCN5-like N-acetyltransferase | 481 | 449 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
- Pfam (hmmscan --cut_ga): TsaD PF00814.32 (E=3e-26)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217938.1)
- Domains: Pfam-A via hmmscan --cut_ga — TsaD (PF00814.32)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1214 - Curated reference: UniProt P9WKY7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
tsaE - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003635|Rv3421c|tsaB MSRVQISTVLAIDTATPAVTAGIVRRHDLVVLGERVTVDARAHAERLTPNVLAALADAALTMADLDAVVVGCGPGPFTGLRAGMASAAAYGHALGIPVYGVCSLDAIGGQTIGDTLVVTDARRREVYWARYCDGIRTVGPAVNAAADVDPGPALAVAGAPEHAALFALPCVEPSRPSPAGLVAAVNWADKPAPLVPLYLRRPDAKPLAVCT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for tsaB? Email the maintainer — the message is pre-filled with this gene's details.