tsaB Family assigned · medium auto-curated

H37Rv Rv3421c · MTBC0 mtbc0_003635 · 211 aa · 3864498–3865133 (-) · RefSeq NP_217938.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
Revised (this work)TRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB. Pfam: TsaD (PF00814.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKY7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv3421c

UniProt still lists this protein as Uncharacterized protein Rv3421c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameyeaZ
eggNOG descriptionPeptidase M22, glycoprotease
Orthologous groupCOG1214
KEGG orthology K14742
Gene Ontology (32) GO:0002949, GO:0005575, GO:0005618, GO:0005623, GO:0006139, GO:0006396, GO:0006399, GO:0006400, GO:0006725, GO:0006807, GO:0008033, GO:0008150 +20 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.389 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TsaDPF00814.32 3.2e-2640–147 tRNA N6-adenosine threonylcarbamoyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tsaE (tRNA threonylcarbamoyladenosine biosynthesis protein), high confidence from genomic context alone (score 996 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3422c tsaE tRNA threonylcarbamoyladenosine biosynthesis protein 999 996 ctx neighborhood:881 coexpression:777 experimental:803 textmining:895
Rv3419c gcp O-sialoglycoprotein endopeptidase 999 996 ctx neighborhood:882 coexpression:546 experimental:922 textmining:895
Rv3420c rimI ribosomal-protein-alanine acetyltransferase RimI 996 974 ctx neighborhood:882 fusion:634 textmining:878
Rv3423c alr alanine racemase 955 906 ctx neighborhood:881 textmining:548
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 617 618 coexpression:503
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 550 551 ctx neighborhood:544
Rv3432c gadB glutamate decarboxylase GadB 544 544 ctx neighborhood:544
Rv1259 udgB uracil DNA glycosylase 540 541 coexpression:503
Rv3418c groES chaperonin GroES 761 533 ctx neighborhood:531 textmining:511
Rv0949 uvrD1 ATP-dependent DNA helicase UvrD 490 491 coexpression:403
Rv2977c thiL thiamine-monophosphate kinase 465 465 coexpression:421
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 463 463
Rv0819 mshD mycothiol acetyltransferase 486 453
Rv2170 GCN5-like N-acetyltransferase 481 449
Rv0428c GCN5-like N-acetyltransferase 481 449

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
  • Pfam (hmmscan --cut_ga): TsaD PF00814.32 (E=3e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217938.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TsaD (PF00814.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1214
  • Curated reference: UniProt P9WKY7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor tsaE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003635|Rv3421c|tsaB
MSRVQISTVLAIDTATPAVTAGIVRRHDLVVLGERVTVDARAHAERLTPNVLAALADAALTMADLDAVVVGCGPGPFTGLRAGMASAAAYGHALGIPVYGVCSLDAIGGQTIGDTLVVTDARRREVYWARYCDGIRTVGPAVNAAADVDPGPALAVAGAPEHAALFALPCVEPSRPSPAGLVAAVNWADKPAPLVPLYLRRPDAKPLAVCT