Rv2803 Family assigned · medium auto-curated

H37Rv Rv2803 · MTBC0 - · 155 aa · 3111822–3112289 (+) · RefSeq YP_177678.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains TacA1 (PF08681.19) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6XFC2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF1778 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionProtein conserved in bacteria
Orthologous groupCOG4453

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.43% of strains (630) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TacA1PF08681.19 5.0e-2572–149 Antitoxin TacA 1-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2802c (arginine/hypothetical protein), medium confidence from genomic context alone (score 582 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2802c arginine/hypothetical protein 583 582 ctx neighborhood:581
Rv0919 GCN5-like N-acetyltransferase 517 515 experimental:451
Rv2801c mazF9 mRNA interferase MazF9 491 491 ctx neighborhood:491
Rv2801A mazE9 antitoxin MazE9 485 484 ctx neighborhood:484
Rv0133 GCN5-like N-acetyltransferase 478 479 experimental:449
Rv2669 GCN5-like N-acetyltransferase 473 471 experimental:451
Rv2170 GCN5-like N-acetyltransferase 473 470 experimental:451
Rv0819 mshD mycothiol acetyltransferase 472 470 experimental:451
Rv0428c GCN5-like N-acetyltransferase 472 470 experimental:451
Rv2775 GCN5-like N-acetyltransferase 470 468 experimental:451
Rv3420c rimI ribosomal-protein-alanine acetyltransferase RimI 470 468 experimental:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): TacA1 PF08681.19 (E=5e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177678.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TacA1 (PF08681.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4453
  • Curated reference: UniProt I6XFC2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor Rv2802c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2803|
MTCPSLVGLRTEAAELSYSDQPDALGVAMRERREQQNLVRPPRRNASRRINTDQTSTKYVYITYMPETLTGRLNFRLSPEQEQALRHAAALTGQSLSGFVLSAAVDHAHDLLARANRIELSEAAFRRFVAALDEPDEAAPELVRLARRKSRIPPH