Rv2803 Family assigned · medium auto-curated
H37Rv Rv2803 · MTBC0 - ·
155 aa · 3111822–3112289 (+) ·
RefSeq YP_177678.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains TacA1 (PF08681.19) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6XFC2
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DUF1778 domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Protein conserved in bacteria |
| Orthologous group | COG4453 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 5 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.43% of strains (630) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TacA1 | PF08681.19 | 5.0e-25 | 72–149 | Antitoxin TacA 1-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2802c (arginine/hypothetical protein), medium confidence from genomic context alone (score 582 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2802c |
arginine/hypothetical protein | 583 | 582 ctx | neighborhood:581 |
Rv0919 |
GCN5-like N-acetyltransferase | 517 | 515 | experimental:451 |
Rv2801c mazF9 |
mRNA interferase MazF9 | 491 | 491 ctx | neighborhood:491 |
Rv2801A mazE9 |
antitoxin MazE9 | 485 | 484 ctx | neighborhood:484 |
Rv0133 |
GCN5-like N-acetyltransferase | 478 | 479 | experimental:449 |
Rv2669 |
GCN5-like N-acetyltransferase | 473 | 471 | experimental:451 |
Rv2170 |
GCN5-like N-acetyltransferase | 473 | 470 | experimental:451 |
Rv0819 mshD |
mycothiol acetyltransferase | 472 | 470 | experimental:451 |
Rv0428c |
GCN5-like N-acetyltransferase | 472 | 470 | experimental:451 |
Rv2775 |
GCN5-like N-acetyltransferase | 470 | 468 | experimental:451 |
Rv3420c rimI |
ribosomal-protein-alanine acetyltransferase RimI | 470 | 468 | experimental:451 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): TacA1 PF08681.19 (E=5e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177678.1)
- Domains: Pfam-A via hmmscan --cut_ga — TacA1 (PF08681.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4453 - Curated reference: UniProt I6XFC2 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
11 functional partner(s); context anchor
Rv2802c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2803| MTCPSLVGLRTEAAELSYSDQPDALGVAMRERREQQNLVRPPRRNASRRINTDQTSTKYVYITYMPETLTGRLNFRLSPEQEQALRHAAALTGQSLSGFVLSAAVDHAHDLLARANRIELSEAAFRRFVAALDEPDEAAPELVRLARRKSRIPPH