Rv1685c Family assigned · medium auto-curated

H37Rv Rv1685c · MTBC0 mtbc0_001793 · 207 aa · 1922791–1923414 (-) · RefSeq NP_216201.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTetR family transcriptional regulator
Revised (this work)TetR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_16 (PF17920.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33187 TrEMBL · unreviewed · Evidence at protein level
UniProt nameHTH tetR-type domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptiontetR family
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.118 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 4.9e-1624–70 Bacterial regulatory proteins, tetR family
TetR_C_16PF17920.7 6.7e-2390–197 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1686c (ABC transporter permease), high confidence from genomic context alone (score 965 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1686c ABC transporter permease 986 965 ctx neighborhood:882 cooccurence:501 coexpression:449 textmining:638
Rv1687c ABC transporter ATP-binding protein 979 811 ctx neighborhood:651 textmining:897
Rv1688 mpg 3-methyladenine DNA glycosylase 724 724 ctx neighborhood:722
Rv1689 tyrS tyrosine--tRNA ligase 479 478 ctx neighborhood:478
Rv1014c pth peptidyl-tRNA hydrolase 402 403 coexpression:400
Rv0685 tuf elongation factor Tu 460 45 textmining:458
Rv1545 hyp hypothetical protein 803 44 textmining:803
Rv1991c mazF6 mRNA interferase MazF6 538 44 textmining:537
Rv0490 senX3 two component sensor histidine kinase SenX3 455 42 textmining:455
Rv3907c pcnA poly(A) polymerase PcnA 656 41 textmining:656

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: TetR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=5e-16), TetR_C_16 PF17920.7 (E=7e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216201.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_16 (PF17920.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt O33187 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv1686c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001793|Rv1685c|
MAAPDNSRRRPGRPAGSSDTRERILSSARELFAHNGIDRTSIRAVAAKAGVDAALVHHYFGTKQQLFAAAIHIPIDPMVIIGPIREAPVEELGYKLPSLLLPIWDSELGAGLIATLRSLISGSDVGLARSFLEEVVTVELGSRVDNPPGTGKIRTQFVASQLMGVVMARYIVRIEPFASLPAEQIVQTIAPNLQRYLTGELPDDLAP