Rv1676 Family assigned · medium auto-curated

H37Rv Rv1676 · MTBC0 mtbc0_001784 · 234 aa · 1913062–1913766 (+) · RefSeq NP_216192.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationperoxiredoxin-like family protein
Revised (this work)Peroxiredoxin-like family protein. Pfam: AhpC-TSA (PF00578.28), AhpC-TSA_2 (PF13911.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53923 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
eggNOG descriptionAhpC/TSA family
Orthologous groupCOG1225

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.205 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AhpC-TSAPF00578.28 1.6e-0651–205 AhpC/TSA family
AhpC-TSA_2PF13911.13 1.0e-0797–211 AhpC/TSA antioxidant enzyme

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dsbF (lipoprotein DsbF), high confidence from genomic context alone (score 810 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1677 dsbF lipoprotein DsbF 974 810 ctx neighborhood:781 textmining:870
Rv1680 hyp hypothetical protein 637 637 ctx neighborhood:566
Rv1675c cmr HTH-type transcriptional regulator Cmr 686 636 ctx neighborhood:558
Rv1681 moeX molybdopterin biosynthesis protein MoeX 635 624 ctx neighborhood:537
Rv1679 fadE16 acyl-CoA dehydrogenase FadE16 591 590 ctx neighborhood:571
Rv1678 integral membrane protein 564 563 ctx neighborhood:540
Rv1682 hyp hypothetical protein 451 451
Rv1004c membrane protein 447 447
Rv3081 hyp hypothetical protein 443 443 ctx cooccurence:443
Rv2735c hyp hypothetical protein 426 426 ctx cooccurence:423
Rv1674c transcriptional regulator 491 360
Rv3673c membrane-anchored thioredoxin-like protein 626 231 textmining:534
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 447 203
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 849 166 textmining:827
Rv2877c integral membrane protein 881 136 textmining:868

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: peroxiredoxin-like family protein
  • Pfam (hmmscan --cut_ga): AhpC-TSA PF00578.28 (E=2e-06), AhpC-TSA_2 PF13911.13 (E=1e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216192.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AhpC-TSA (PF00578.28), AhpC-TSA_2 (PF13911.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1225
  • Curated reference: UniProt O53923 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor dsbF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001784|Rv1676|
MACPEWEISRSKRTRKPVLRPRHSVSTLTNRFLAEFCHRYGIGVPTRLARGATVPTRRLQDINDQPVDVPAATGRTHLQFRRFAACPICHLHLRSFANRHQEVADSGITEVVFFHSAADALRGYQSLLPFAVIADPDRVQYREFGVEKSLGAITHPRALWAAVRGSAAMLHRNDPERAGVGFGDGTTHLGLPADFLLDADGTVAAVHYGRHADDQWSVDQLIDINRSLGGKGTQ