fadE16 Family assigned · medium auto-curated

H37Rv Rv1679 · MTBC0 mtbc0_001787 · 373 aa · 1915314–1916435 (+) · RefSeq NP_216195.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyl-CoA dehydrogenase FadE16
MTBC0 PGAP re-annotationacyl-CoA dehydrogenase family protein
Revised (this work)Acyl-CoA dehydrogenase family protein. Pfam: Acyl-CoA_dh_N (PF02771.22), Acyl-CoA_dh_M (PF02770.25), Acyl-CoA_dh_1 (PF00441.30), Acyl-CoA_dh_2 (PF08028.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53926 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible acyl-CoA dehydrogenase FadE16

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namefadE16
eggNOG descriptionAcyl-CoA dehydrogenase, C-terminal domain
Orthologous groupCOG1960

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.491 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acyl-CoA_dh_NPF02771.22 2.7e-1114–85 Acyl-CoA dehydrogenase, N-terminal domain
Acyl-CoA_dh_MPF02770.25 6.0e-14111–199 Acyl-CoA dehydrogenase, middle domain
Acyl-CoA_dh_1PF00441.30 8.3e-15215–353 Acyl-CoA dehydrogenase, C-terminal domain
Acyl-CoA_dh_2PF08028.17 2.5e-10232–350 Acyl-CoA dehydrogenase, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moeX (molybdopterin biosynthesis protein MoeX), high confidence from genomic context alone (score 985 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1680 hyp hypothetical protein 989 989 ctx neighborhood:879 cooccurence:415 coexpression:860
Rv1681 moeX molybdopterin biosynthesis protein MoeX 984 985 ctx neighborhood:879 coexpression:860
Rv1678 integral membrane protein 982 982 ctx neighborhood:881 coexpression:855
Rv3028c fixB electron transfer flavoprotein subunit alpha 908 838 ctx cooccurence:534 coexpression:435 experimental:419 textmining:459
Rv3029c fixA electron transfer flavoprotein subunit beta 848 819 ctx cooccurence:499 coexpression:413 experimental:418
Rv0860 fadB fatty oxidation protein FadB 803 788 coexpression:647
Rv1933c fadE18 acyl-CoA dehydrogenase FadE18 768 768 ctx cooccurence:766
Rv3139 fadE24 acyl-CoA dehydrogenase 743 744 ctx cooccurence:737
Rv3505 fadE27 acyl-CoA dehydrogenase FadE27 737 737 ctx cooccurence:737
Rv2760c vapB42 antitoxin VapB42 734 734 coexpression:734
Rv3401 glycosyl hydrolase 716 716 coexpression:716
Rv1934c fadE17 acyl-CoA dehydrogenase FadE17 706 706 ctx cooccurence:702
Rv3564 fadE33 acyl-CoA dehydrogenase FadE33 698 699 ctx cooccurence:697
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 696 697 ctx cooccurence:695
Rv3563 fadE32 acyl-CoA dehydrogenase FadE32 649 649 ctx cooccurence:647

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyl-CoA dehydrogenase FadE16
  • MTBC0 PGAP product: acyl-CoA dehydrogenase family protein
  • Pfam (hmmscan --cut_ga): Acyl-CoA_dh_N PF02771.22 (E=3e-11), Acyl-CoA_dh_M PF02770.25 (E=6e-14), Acyl-CoA_dh_1 PF00441.30 (E=8e-15), Acyl-CoA_dh_2 PF08028.17 (E=3e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216195.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyl-CoA_dh_N (PF02771.22), Acyl-CoA_dh_M (PF02770.25), Acyl-CoA_dh_1 (PF00441.30), Acyl-CoA_dh_2 (PF08028.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1960
  • Curated reference: UniProt O53926 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 146 functional partner(s); context anchor moeX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001787|Rv1679|fadE16
MATPGVVQEVVSVAAEHAERVDTDCAFPAEAVDALRKTGLLGLVLPREIGGMGSGPVEFTEVVAQLSAACGSTAMIYLMHMAAAVTVAASPPPGLPDLLADMASGKQLGTLAFSEPGSRSHFWAPVSTASADGDGIAVRADKSWVTSAGFADVYVVSVGSADGAAGDVDLYAVPADTPGLRVAGTFTGMGLRGNASAPMAVDIRIPDSYRLGEAGGGFGIMMQTVLPWFNLGNAAVSLGLATAATGAAVKHVGTARLEHLGGSLAELPTIRAQIARMGTTLAAQKAYLEVAANSVSSPDDTTLTHVLGVKASVNDAALTITESAMRVCGGAAFSKHLPIERAFRDARAGSVMAPTADALYDFYGRAVTGLPLF