Rv1680 Family assigned · medium auto-curated

H37Rv Rv1680 · MTBC0 mtbc0_001788 · 274 aa · 1916444–1917268 (+) · RefSeq NP_216196.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationphosphate/phosphite/phosphonate ABC transporter substrate-binding protein
Revised (this work)Phosphate/phosphite/phosphonate ABC transporter substrate-binding protein. Pfam: Phosphonate-bd (PF12974.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33182 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhosphate ABC transporter substrate-binding protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionABC transporter, phosphonate, periplasmic substrate-binding protein
Orthologous groupCOG3221

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.403 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Phosphonate-bdPF12974.13 2.1e-3435–258 ABC transporter, phosphonate, periplasmic substrate-binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE16 (acyl-CoA dehydrogenase FadE16), high confidence from genomic context alone (score 989 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1679 fadE16 acyl-CoA dehydrogenase FadE16 989 989 ctx neighborhood:879 cooccurence:415 coexpression:860
Rv1681 moeX molybdopterin biosynthesis protein MoeX 988 988 ctx neighborhood:882 coexpression:863
Rv1678 integral membrane protein 976 977 ctx neighborhood:879 coexpression:815
Rv0273c transcriptional regulator 733 733 coexpression:733
Rv2760c vapB42 antitoxin VapB42 733 733 coexpression:733
Rv3727 oxidoreductase 669 670 coexpression:615
Rv1676 hyp hypothetical protein 637 637 ctx neighborhood:566
Rv1682 hyp hypothetical protein 628 615 ctx neighborhood:497
Rv1675c cmr HTH-type transcriptional regulator Cmr 596 586
Rv1677 dsbF lipoprotein DsbF 544 544 ctx neighborhood:529
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 461 428 coexpression:428
Rv0911 hyp hypothetical protein 422 423 coexpression:423
Rv3164c moxR3 methanol dehydrogenase transcriptional regulator MoxR 404 404 coexpression:404
Rv2759c vapC42 ribonuclease VapC42 404 404 coexpression:404
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 455 397

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: phosphate/phosphite/phosphonate ABC transporter substrate-binding protein
  • Pfam (hmmscan --cut_ga): Phosphonate-bd PF12974.13 (E=2e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216196.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Phosphonate-bd (PF12974.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3221
  • Curated reference: UniProt O33182 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor fadE16
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001788|Rv1680|
MSTEPLVVGAVAYTPNVVPIWEGIRGYFQDSESPDTQMDFVLYSNYARLVDSLIAGHIDIAWNTNLAYVRTVLQTGGRCTPLAQRDTDVDYTTVFVAHAGSDLHGAKDIAGKRLALGSADSAHAAILPLYYLRRAGIAESDLQVIRFDTDIGKHGDTGRSELDAVDAVLAGEADVAAIGSSTWAAMGAAELMGESLTEVWRTDGYCHCMFTALDTLPAERYQPWLDRLLAMSWDDSEHRKILELEGLRRWVPPHLDGYKPLFEAVQEQGIDPRW