Rv1674c Family assigned · medium auto-curated

H37Rv Rv1674c · MTBC0 mtbc0_001781 · 218 aa · 1911275–1911931 (-) · RefSeq NP_216190.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationmetalloregulator ArsR/SmtB family transcription factor
Revised (this work)Metalloregulator ArsR/SmtB family transcription factor. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27), Rhodanese (PF00581.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53921 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionRhodanese-like domain
Orthologous groupCOG0607

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.737 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 3.0e-0619–68 Helix-turn-helix domain
HTH_5PF01022.27 3.1e-0724–67 Bacterial regulatory protein, arsR family
RhodanesePF00581.26 2.4e-16120–210 Rhodanese-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cmr (HTH-type transcriptional regulator Cmr), high confidence from genomic context alone (score 903 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1675c cmr HTH-type transcriptional regulator Cmr 918 903 ctx neighborhood:420 coexpression:839
Rv1931c transcriptional regulator 864 864 coexpression:862
Rv3167c TetR family transcriptional regulator 866 861 coexpression:861
Rv0494 HTH-type transcriptional regulator 866 861 coexpression:859
Rv1267c embR transcriptional regulator EmbR 860 860 coexpression:860
Rv0212c nadR transcriptional regulator NadR 860 860 coexpression:860
Rv3840 transcriptional regulator 860 860 coexpression:860
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 863 858 coexpression:858
Rv3830c TetR family transcriptional regulator 859 854 coexpression:854
Rv3736 AraC/XylS family transcriptional regulator 859 851 coexpression:848
Rv1359 transcriptional regulator 850 850 coexpression:850
Rv3082c virS HTH-type transcriptional regulator VirS 853 845 coexpression:841
Rv3124 moaR1 transcriptional regulator MoaR 845 845 coexpression:845
Rv0194 multidrug ABC transporter ATPase/permease 850 844 coexpression:772
Rv1151c cobB NAD-dependent protein deacylase 841 841 coexpression:836

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: metalloregulator ArsR/SmtB family transcription factor
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=3e-06), HTH_5 PF01022.27 (E=3e-07), Rhodanese PF00581.26 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216190.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27), Rhodanese (PF00581.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0607
  • Curated reference: UniProt O53921 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 131 functional partner(s); context anchor cmr
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001781|Rv1674c|
MSGAKKLIFEQFALVGQALSSGHRLELLDLLVQGERSVDALARASGLTFANASQHLLQLRRAGLVTSRRDGKRVIYALSDPQVWDVVRAVRAVAERNLASVGSLVRQYYTDRDSLEPISRDELQARVAAGSVLVLDVRPAMEYAAGHLPGAVSIPLDELAERLDELPSGIDIVACCRGPYCVYAYDALELLRPNGFSARRLDGGFSEWLAADLPVVRT