cmr Family assigned · medium auto-curated
H37Rv Rv1675c · MTBC0 mtbc0_001783 ·
244 aa ·
1912256–1912990 MTBC0
(-) ·
RefSeq NP_216191.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | HTH-type transcriptional regulator Cmr |
|---|---|
| MTBC0 PGAP re-annotation | HTH-type transcriptional regulator Cmr |
| Revised (this work) | HTH-type transcriptional regulator Cmr. Pfam: cNMP_binding (PF00027.36), HTH_Crp_2 (PF13545.13). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 29 publications
29 TB publications mention this gene. 29 publication(s) discuss this gene (28 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Long-term mortality and cause of death in people with tuberculosis compared with matched controls with influenza or non-typhoid salmonellosis in Australia: a retrospective cohort study. doi:10.1136/bmjph-2024-001848 | 2026 |
| Imaging and Circulating Biomarker-Defined Cardiac Pathology in Pulmonary Tuberculosis: A Systematic Review. doi:10.5334/gh.1369 | 2024 |
| [Analysis and prediction of epidemiological characteristics of tuberculosis deaths among Chinese residents from 2006 to 2021]. doi:10.3760/cma.j.cn112338-20231114-00286 | 2024 |
| Novel role of cardiovascular MRI to contextualise tuberculous pericardial inflammation and oedema as predictors of constrictive pericarditis. doi:10.3389/fcvm.2024.1329767 | 2024 |
| Myocarditis with concomitant tuberculosis infection presenting with solitary ventricular tachycardia: a case report. doi:10.1093/ehjcr/ytad432 | 2023 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.14 (95% CI -0.34 to 3.54). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in transcriptional mechanism |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1702c
· 99.6% identity |
|---|---|
| M. marinum |
MMAR_1621
· 66.8% identity |
| M. orygis |
RJtmp_001751
· 99.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMH5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | HTH-type transcriptional regulator Cmr |
| Curated function | Positively regulates the expression of at least groEL2. Cyclic AMP does not affect transcription in vitro. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | transcriptional |
| Orthologous group | COG0664 |
| KEGG orthology |
K21884
|
| Gene Ontology (25) |
GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0019219, GO:0019222, GO:0031323 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.448 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (248) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 13/53 (24%) · mean identity 73.1%
· 2/4 closest MTBAP relatives present in a subset of the genus (13/53 NTM; in 2 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 2/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 35.3% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 89.8181818182. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 8.74 ppm · rank 2731/3519 (22.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 244 aa |
|---|---|
| Molecular weight | 26.8 kDa |
| Theoretical pI | 10.11 |
| GRAVY | 0.009 (hydrophobic) |
| Aliphatic index | 106.8 |
| Aromaticity | 0.041 |
| Instability index | 47.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
cNMP_binding | PF00027.36 | 1.8e-19 | 60–146 | Cyclic nucleotide-binding domain |
HTH_Crp_2 | PF13545.13 | 3.9e-11 | 179–241 | Crp-like helix-turn-helix domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5w5a |
X-ray diffraction | 1.85 Å | 100% |
5w5b |
X-ray diffraction | 1.8 Å | 95% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5w5b-assembly1_A |
1.00 | 1.00 | 1.1e-41 sig | 5w5b-assembly1_A Crystal structure of Mycobacterium tuberculosis CRP-FNR family transcription factor Cmr (Rv1675c), truncated construct |
4cyd-assembly2_A |
1.00 | 0.75 | 8.7e-16 sig | 4cyd-assembly2_A GlxR bound to cAMP |
3i54-assembly2_C |
1.00 | 0.75 | 3.5e-15 sig | 3i54-assembly2_C Crystal structure of MtbCRP in complex with cAMP |
3h3u-assembly1_A |
1.00 | 0.78 | 6.9e-15 sig | 3h3u-assembly1_A Crystal structure of CRP (cAMP receptor Protein) from Mycobacterium tuberculosis |
4cyd-assembly2_C |
1.00 | 0.71 | 3.3e-15 sig | 4cyd-assembly2_C GlxR bound to cAMP |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1674c (- strand, 324 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1676 (+ strand, 71 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulon | this transcription factor regulates 1 target gene(s) |
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1674c (transcriptional regulator), high confidence from genomic context alone (score 903 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2488c exp |
LuxR family transcriptional regulator | 935 | 932 | coexpression:856 experimental:440 |
Rv1674c |
transcriptional regulator | 918 | 903 ctx | neighborhood:420 coexpression:839 |
Rv1359 |
transcriptional regulator | 898 | 895 | coexpression:833 |
Rv0602c tcrA |
two component DNA binding transcriptional regulator TcrA | 877 | 870 | coexpression:854 |
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI | 870 | 865 | coexpression:845 |
Rv2282c |
LysR family HTH-type transcriptional regulator | 869 | 862 | coexpression:862 |
Rv3736 |
AraC/XylS family transcriptional regulator | 865 | 860 | coexpression:860 |
Rv1931c |
transcriptional regulator | 861 | 860 | coexpression:860 |
Rv3840 |
transcriptional regulator | 860 | 860 | coexpression:860 |
Rv1267c embR |
transcriptional regulator EmbR | 860 | 860 | coexpression:860 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 860 | 860 | coexpression:860 |
Rv3167c |
TetR family transcriptional regulator | 859 | 859 | coexpression:859 |
Rv1190 hyp |
hypothetical protein | 851 | 851 | coexpression:850 |
Rv0603 hyp |
hypothetical protein | 850 | 850 | coexpression:850 |
Rv3263 |
DNA methylase | 848 | 848 | coexpression:848 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: HTH-type transcriptional regulator Cmr
- MTBC0 PGAP product: HTH-type transcriptional regulator Cmr
- Pfam (hmmscan --cut_ga): cNMP_binding PF00027.36 (E=2e-19), HTH_Crp_2 PF13545.13 (E=4e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216191.1)
- Domains: Pfam-A via hmmscan --cut_ga — cNMP_binding (PF00027.36), HTH_Crp_2 (PF13545.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0664 - Curated reference: UniProt P9WMH5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
161 functional partner(s); context anchor
Rv1674c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001783|Rv1675c|cmr MADRSVRPLRHLVHAVTGGQPPSEAQVRQAAWIARCVGRGGSAPLHRDDVSALAETLQAKEFAPGAVVFHADQTADGVWIVRHGLIELAVGSRRRRAVVNILHPGDVDGDIPLLLEMPMVYTGRALTQATCLFLDRQAFERLLATHPAIARRWLSSVAQRVSTAQIRLMGMLGRPLPAQVAQLLLDEAIDARIELAQRTLAAMLGAQRPSINKILKEFERDRLITVGYAVIEITDQHGLRARAQ
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cmr? Email the maintainer — the message is pre-filled with this gene's details.