Rv1693 Still unknown · low auto-curated
H37Rv Rv1693 · MTBC0 mtbc0_001801 ·
58 aa · 1929771–1929947 (+) ·
RefSeq NP_216209.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3dxr-assembly1_B Crystal structure of the yeast inter-membrane space c (prob 0.44, TM 0.55). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O33195
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 29V0T |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 68.5 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
3dxr-assembly1_B |
0.44 | 0.55 | 8.8e-01 | 3dxr-assembly1_B Crystal structure of the yeast inter-membrane space chaperone assembly TIM9.10 |
6lo8-assembly1_H |
0.33 | 0.57 | 1.6e+00 | 6lo8-assembly1_H Cryo-EM structure of the TIM22 complex from yeast |
8axk-assembly1_N |
0.33 | 0.71 | 2.4e+00 | 8axk-assembly1_N Type 3 secretion system export apparatus core, inner rod and needle of Shigella flexneri |
6xyw-assembly1_Bd |
0.23 | 0.73 | 3.7e+00 | 6xyw-assembly1_Bd Structure of the plant mitochondrial ribosome |
8t9d-assembly1_W |
0.16 | 0.61 | 3.2e+00 | 8t9d-assembly1_W CryoEM structure of TR-TRAP |
8vb0-assembly1_H-2 |
0.15 | 0.73 | 6.6e+00 | 8vb0-assembly1_H-2 Asymmetric unit of bacteriophage PhiM1 mature capsid |
8vb0-assembly1_H-4 |
0.15 | 0.73 | 6.6e+00 | 8vb0-assembly1_H-4 Asymmetric unit of bacteriophage PhiM1 mature capsid |
8vb0-assembly1_H-6 |
0.15 | 0.73 | 6.6e+00 | 8vb0-assembly1_H-6 Asymmetric unit of bacteriophage PhiM1 mature capsid |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ppnK (inorganic polyphosphate/ATP-NAD kinase), high confidence from genomic context alone (score 884 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1695 ppnK |
inorganic polyphosphate/ATP-NAD kinase | 984 | 884 ctx | neighborhood:882 textmining:870 |
Rv1691 hyp |
hypothetical protein | 984 | 883 ctx | neighborhood:882 textmining:870 |
Rv1694 tlyA |
16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA | 945 | 883 ctx | neighborhood:882 textmining:548 |
Rv1692 |
phosphatase | 984 | 882 ctx | neighborhood:882 textmining:870 |
Rv1696 recN |
DNA repair protein RecN | 981 | 869 ctx | neighborhood:867 textmining:861 |
Rv1690 lprJ |
lipoprotein LprJ | 735 | 735 ctx | neighborhood:732 |
Rv1697 steA hyp |
hypothetical protein | 608 | 608 ctx | neighborhood:606 |
Rv1698 mctB |
copper transporter MctB | 576 | 577 ctx | neighborhood:574 |
Rv1700 |
NUDIX hydrolase | 459 | 459 ctx | neighborhood:451 |
Rv1699 pyrG |
CTP synthase | 437 | 437 ctx | neighborhood:431 |
Rv1701 xerD |
tyrosine recombinase XerD | 408 | 408 ctx | neighborhood:402 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 3dxr-assembly1_B Crystal structure of the yeast inter-membrane space chaperone a (prob 0.44, E=9e-01, TM=0.55)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216209.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
29V0T - Curated reference: UniProt O33195 (TrEMBL, unreviewed; Evidence at protein level)
- Model confidence: ESMFold per-residue pLDDT (mean 68.5, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
11 functional partner(s); context anchor
ppnK - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001801|Rv1693| MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG