Rv1693 Still unknown · low auto-curated

H37Rv Rv1693 · MTBC0 mtbc0_001801 · 58 aa · 1929771–1929947 (+) · RefSeq NP_216209.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3dxr-assembly1_B Crystal structure of the yeast inter-membrane space c (prob 0.44, TM 0.55).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33195 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group29V0T

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 68.5 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3dxr-assembly1_B 0.44 0.55 8.8e-01 3dxr-assembly1_B Crystal structure of the yeast inter-membrane space chaperone assembly TIM9.10
6lo8-assembly1_H 0.33 0.57 1.6e+00 6lo8-assembly1_H Cryo-EM structure of the TIM22 complex from yeast
8axk-assembly1_N 0.33 0.71 2.4e+00 8axk-assembly1_N Type 3 secretion system export apparatus core, inner rod and needle of Shigella flexneri
6xyw-assembly1_Bd 0.23 0.73 3.7e+00 6xyw-assembly1_Bd Structure of the plant mitochondrial ribosome
8t9d-assembly1_W 0.16 0.61 3.2e+00 8t9d-assembly1_W CryoEM structure of TR-TRAP
8vb0-assembly1_H-2 0.15 0.73 6.6e+00 8vb0-assembly1_H-2 Asymmetric unit of bacteriophage PhiM1 mature capsid
8vb0-assembly1_H-4 0.15 0.73 6.6e+00 8vb0-assembly1_H-4 Asymmetric unit of bacteriophage PhiM1 mature capsid
8vb0-assembly1_H-6 0.15 0.73 6.6e+00 8vb0-assembly1_H-6 Asymmetric unit of bacteriophage PhiM1 mature capsid

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ppnK (inorganic polyphosphate/ATP-NAD kinase), high confidence from genomic context alone (score 884 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 984 884 ctx neighborhood:882 textmining:870
Rv1691 hyp hypothetical protein 984 883 ctx neighborhood:882 textmining:870
Rv1694 tlyA 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA 945 883 ctx neighborhood:882 textmining:548
Rv1692 phosphatase 984 882 ctx neighborhood:882 textmining:870
Rv1696 recN DNA repair protein RecN 981 869 ctx neighborhood:867 textmining:861
Rv1690 lprJ lipoprotein LprJ 735 735 ctx neighborhood:732
Rv1697 steA hyp hypothetical protein 608 608 ctx neighborhood:606
Rv1698 mctB copper transporter MctB 576 577 ctx neighborhood:574
Rv1700 NUDIX hydrolase 459 459 ctx neighborhood:451
Rv1699 pyrG CTP synthase 437 437 ctx neighborhood:431
Rv1701 xerD tyrosine recombinase XerD 408 408 ctx neighborhood:402

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 3dxr-assembly1_B Crystal structure of the yeast inter-membrane space chaperone a (prob 0.44, E=9e-01, TM=0.55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216209.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 29V0T
  • Curated reference: UniProt O33195 (TrEMBL, unreviewed; Evidence at protein level)
  • Model confidence: ESMFold per-residue pLDDT (mean 68.5, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor ppnK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001801|Rv1693|
MTIDPDQIRAEIDALLASLPDPADAENGPSLAELEGIARRLSEAHEVLLAALESAEKG