dsbF Resolved · high auto-curated

H37Rv Rv1677 · MTBC0 mtbc0_001785 · 182 aa · 1913763–1914311 (+) · RefSeq NP_216193.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein DsbF
MTBC0 PGAP re-annotationprotein disulfide oxidoreductase
Revised (this work)Protein disulfide oxidoreductase. Pfam: Redoxin (PF08534.17), AhpC-TSA (PF00578.28), Thioredoxin_2 (PF13098.14), Thioredoxin (PF00085.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XYM2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSoluble secreted antigen MPT53
Curated functionDisulfide oxidoreductase that catalyzes the oxidation of reduced, unfolded secreted proteins to form disulfide bonds. Despite a weak homology to thioredoxin this cannot serve as a substrate for thioredoxin reductase.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
O Post-translational modification, protein turnover, chaperones
Preferred namedsbF
eggNOG descriptionpossibly involved in thiol disulfide interchange. contains PS00013 prokaryotic membrane lipoprotein lipid attachment site, N-term signal pepitde sequence and PS00194 thioredoxin family active site
Orthologous groupCOG0526

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.342 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RedoxinPF08534.17 4.6e-1244–160 Redoxin
AhpC-TSAPF00578.28 1.1e-1453–161 AhpC/TSA family
Thioredoxin_2PF13098.14 3.1e-0771–175 Thioredoxin-like domain
ThioredoxinPF00085.27 9.4e-0672–127 Thioredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2877c (integral membrane protein), high confidence from genomic context alone (score 783 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 882 831 experimental:468 database:611
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 832 821 experimental:562 database:596
Rv1676 hyp hypothetical protein 974 810 ctx neighborhood:781 textmining:870
Rv2877c integral membrane protein 972 783 ctx cooccurence:699 textmining:876
Rv0462 lpdC dihydrolipoamide dehydrogenase 763 753 experimental:410 database:550
Rv3303c lpdA NAD(P)H quinone reductase LpdA 755 745 experimental:410 database:550
Rv0794c oxidoreductase 754 743 experimental:410 database:550
Rv2855 mtr mycothione reductase 754 743 experimental:410 database:550
Rv2713 sthA pyridine nucleotide transhydrogenase 753 742 experimental:410 database:550
Rv3672c hyp hypothetical protein 734 724 coexpression:649
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 712 697 database:578
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 709 695 database:578
Rv2674 msrB peptide methionine sulfoxide reductase MsrB 677 656 database:594
Rv0432 sodC superoxide dismutase 677 656 database:595
Rv0038 hyp hypothetical protein 632 619 database:602

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein DsbF
  • MTBC0 PGAP product: protein disulfide oxidoreductase
  • Pfam (hmmscan --cut_ga): Redoxin PF08534.17 (E=5e-12), AhpC-TSA PF00578.28 (E=1e-14), Thioredoxin_2 PF13098.14 (E=3e-07), Thioredoxin PF00085.27 (E=9e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216193.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Redoxin (PF08534.17), AhpC-TSA (PF00578.28), Thioredoxin_2 (PF13098.14), Thioredoxin (PF00085.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0526
  • Curated reference: UniProt I6XYM2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 106 functional partner(s); context anchor Rv2877c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001785|Rv1677|dsbF
MTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAATQVPAGQTVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWAPWCPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNVDVVRGRMSQDELTRRVTALTSR