Rv1473A Family assigned · medium auto-curated

H37Rv Rv1473A · MTBC0 - · 63 aa · 1662381–1662572 (+) · RefSeq YP_177644.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator. Pfam: HTH_58 (PF19575.6).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N691 TrEMBL · unreviewed · Predicted
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiontranscriptional regulator
Orthologous group2E4I7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 1.35% of strains (1956) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_58PF19575.6 2.7e-216–58 Helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1473 (macrolide ABC transporter ATP-binding protein), high confidence from genomic context alone (score 940 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1473 macrolide ABC transporter ATP-binding protein 940 940 ctx neighborhood:774 coexpression:746
Rv1472 echA12 enoyl-CoA hydratase EchA12 745 745 ctx neighborhood:741
Rv2314c hyp hypothetical protein 606 606 ctx cooccurence:606
Rv3287c rsbW anti-sigma factor RsbW 578 579 ctx cooccurence:576
Rv2709 transmembrane protein 551 552 ctx cooccurence:549
Rv2844 hyp hypothetical protein 546 546 ctx cooccurence:541
Rv3662c hyp hypothetical protein 541 541 ctx cooccurence:540
Rv2315c hyp hypothetical protein 531 531 ctx cooccurence:531
Rv3231c hyp hypothetical protein 510 510 ctx cooccurence:488
Rv2170 GCN5-like N-acetyltransferase 478 479 ctx cooccurence:477
Rv2912c TetR family HTH-type transcriptional regulator 469 469
Rv3118 sseC1 hyp hypothetical protein 469 469 ctx cooccurence:456
Rv0546c hyp hypothetical protein 467 467 ctx cooccurence:467
Rv1471 trxB1 thioredoxin 463 463 ctx neighborhood:460
Rv0814c sseC2 hyp hypothetical protein 458 459 ctx cooccurence:456

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator
  • Pfam (hmmscan --cut_ga): HTH_58 PF19575.6 (E=3e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177644.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_58 (PF19575.6)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E4I7
  • Curated reference: UniProt L7N691 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv1473
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1473A|
MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR