mazF6 Resolved · high auto-curated

H37Rv Rv1991c · MTBC0 mtbc0_002117 · 114 aa · 2257918–2258262 (-) · RefSeq NP_216507.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mRNA interferase MazF6
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin endoribonuclease MazF6
Revised (this work)Type II toxin-antitoxin system toxin endoribonuclease MazF6. Pfam: PemK_toxin (PF02452.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WII3 SwissProt · reviewed · Evidence at protein level
UniProt nameEndoribonuclease MazF6
EC (curated) EC 3.1.27.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and in M.smegmatis partially inhibits cell growth and colony formation; its toxic effect is neutralized by coexpression with cognate antitoxin MazE6. Acts as an mRNA interferase on ssRNA, cleaving between the second and third bases in the sequences CUCCU and UUCCU. Further experiments demonstrate that it digests between the first and second bases of UCCUU, yielding a 5'-hydroxyl end; digests M.tuberculosis mRNA (in coding as well as the 5'- and 3'-UTR regions) and 23S rRNA, digests E.coli 16S rRNA both alone an.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module
Orthologous groupCOG2337
KEGG orthology K07171
Gene Ontology (57) GO:0003674, GO:0003824, GO:0004518, GO:0004540, GO:0005575, GO:0005576, GO:0006139, GO:0006401, GO:0006402, GO:0006725, GO:0006807, GO:0008150 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.734 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PemK_toxinPF02452.24 2.3e-275–112 PemK-like, MazF-like toxin of type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazE6 (antitoxin MazE6), high confidence from genomic context alone (score 950 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1991A mazE6 antitoxin MazE6 990 950 ctx neighborhood:882 experimental:434 textmining:820
Rv2801A mazE9 antitoxin MazE9 844 785 experimental:677
Rv2063 mazE7 antitoxin MazE7 743 688 experimental:677
Rv1990A Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g 607 606 ctx neighborhood:594
Rv1992c ctpG cation transporter ATPase G 551 551 ctx neighborhood:536
Rv1993c hyp hypothetical protein 550 550 ctx neighborhood:536
Rv2063A mazF7 mRNA interferase MazF7 528 528 ctx cooccurence:528
Rv1994c cmtR HTH-type transcriptional regulator CmtR 435 435 ctx neighborhood:432
Rv1725c hyp hypothetical protein 416 416 coexpression:416
Rv3095 HTH-type transcriptional regulator 414 415 coexpression:415
Rv0456A mazF1 toxin MazF1 555 402
Rv1494 mazE4 antitoxin MazE4 477 400
Rv1495 mazF4 mRNA interferase MazF4 864 339 textmining:803
Rv1960c parD1 antitoxin ParD1 415 337
Rv1103c mazE3 antitoxin MazE3 762 334 textmining:659

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: mRNA interferase MazF6
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin endoribonuclease MazF6
  • Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=2e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216507.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2337
  • Curated reference: UniProt P9WII3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor mazE6
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002117|Rv1991c|mazF6
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL