mazF6 Resolved · high auto-curated
H37Rv Rv1991c · MTBC0 mtbc0_002117 ·
114 aa ·
2257918–2258262 MTBC0
(-) ·
RefSeq NP_216507.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | mRNA interferase MazF6 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system toxin endoribonuclease MazF6 |
| Revised (this work) | Type II toxin-antitoxin system toxin endoribonuclease MazF6. Pfam: PemK_toxin (PF02452.24). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (9 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Toxin-antitoxin Genes Expression in Multidrug-resistant Mycobacterium tuberculosis Isolates under Drug Exposure. doi:10.2174/1871526523666230524144448 | 2023 |
| Functional and Biochemical Characterization of the MazEF6 Toxin-Antitoxin System of Mycobacterium tuberculosis. doi:10.1128/jb.00058-22 | 2022 |
| Rapid Identification of Secondary Structure and Binding Site Residues in an Intrinsically Disordered Protein Segment. doi:10.3389/fgene.2021.755292 | 2021 |
| Comparison of toxin-antitoxin expression among drug-susceptible and drug-resistant clinical isolates of Mycobacterium tuberculosis. doi:10.5603/ARM.a2021.0033 | 2021 |
| MazF ribonucleases promote Mycobacterium tuberculosis drug tolerance and virulence in guinea pigs. doi:10.1038/ncomms7059 | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene
| Neighbour | Rv1991A (Rv1991A, - strand) |
|---|---|
| Overlap | 7 bp, 2 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.05 (95% CI -0.71 to 0.95). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Sequence-specific mRNA cleavage |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2014c
· 99.1% identity |
|---|---|
| M. orygis |
RJtmp_002057
· 99.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WII3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Endoribonuclease MazF6 |
| EC (curated) |
EC 3.1.27.-
|
| Curated function | Toxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and in M.smegmatis partially inhibits cell growth and colony formation; its toxic effect is neutralized by coexpression with cognate antitoxin MazE6. Acts as an mRNA interferase on ssRNA, cleaving between the second and third bases in the sequences CUCCU and UUCCU. Further experiments demonstrate that it digests between the first and second bases of UCCUU, yielding a 5'-hydroxyl end; digests M.tuberculosis mRNA (in coding as well as the 5'- and 3'-UTR regions) and 23S rRNA, digests E.coli 16S rRNA both alone an. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| eggNOG description | Toxic component of a toxin-antitoxin (TA) module |
| Orthologous group | COG2337 |
| KEGG orthology |
K07171
|
| Gene Ontology (57) |
GO:0003674, GO:0003824, GO:0004518, GO:0004540, GO:0005575, GO:0005576, GO:0006139, GO:0006401, GO:0006402, GO:0006725, GO:0006807, GO:0008150 +45 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.734 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 5/53 (9%) · mean identity 66.1%
· 2/4 closest MTBAP relatives present in a subset of the genus (5/53 NTM; in 2 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 37.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 6 in the ORF — 0 in the essential state, 0 growth-defect, 6 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 320.166666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -1.96 | 0.023 | required |
| fitness in mouse infection (in vivo) | -1.73 | 0.019 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 121.0 ppm · rank 1160/3519 (67.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 114 aa |
|---|---|
| Molecular weight | 12.3 kDa |
| Theoretical pI | 9.51 |
| GRAVY | 0.127 (hydrophobic) |
| Aliphatic index | 108.6 |
| Aromaticity | 0.035 |
| Instability index | 54.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PemK_toxin | PF02452.24 | 2.3e-27 | 5–112 | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
Experimental structures (Protein Data Bank) 5 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5hk3 |
X-ray diffraction | 1.56 Å | 100% |
5hkc |
X-ray diffraction | 1.68 Å | 100% |
5hk0 |
X-ray diffraction | 2.25 Å | 100% |
8zws |
X-ray diffraction | 3.27 Å | 100% |
9ikd |
X-ray diffraction | 3.32 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (5 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5hk0-assembly1_A |
1.00 | 0.97 | 4.3e-20 sig | 5hk0-assembly1_A Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA |
5hk3-assembly1_A |
1.00 | 0.96 | 3.2e-20 sig | 5hk3-assembly1_A Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with DNA |
5hk0-assembly1_B |
1.00 | 0.97 | 3.6e-18 sig | 5hk0-assembly1_B Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA |
5hk0-assembly2_C |
1.00 | 0.97 | 3.8e-18 sig | 5hk0-assembly2_C Crystal structure of M. tuberculosis MazF-mt3 (Rv1991c) in complex with RNA |
5hkc-assembly1_B |
1.00 | 0.91 | 4.7e-19 sig | 5hkc-assembly1_B Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv1990c (- strand, 667 bp gap) |
|---|---|
| Downstream (3' on genome) | mazE6 (- strand, -7 bp gap) |
| Predicted operon |
mazF6 · mazE6
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mazE6 (antitoxin MazE6), high confidence from genomic context alone (score 950 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1991A mazE6 exp |
antitoxin MazE6 | 990 | 950 ctx | neighborhood:882 experimental:434 textmining:820 |
Rv2801A mazE9 exp |
antitoxin MazE9 | 844 | 785 | experimental:677 |
Rv2063 mazE7 exp |
antitoxin MazE7 | 743 | 688 | experimental:677 |
Rv1990A |
Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g | 607 | 606 ctx | neighborhood:594 |
Rv1992c ctpG |
cation transporter ATPase G | 551 | 551 ctx | neighborhood:536 |
Rv1993c hyp |
hypothetical protein | 550 | 550 ctx | neighborhood:536 |
Rv2063A mazF7 |
mRNA interferase MazF7 | 528 | 528 ctx | cooccurence:528 |
Rv1994c cmtR |
HTH-type transcriptional regulator CmtR | 435 | 435 ctx | neighborhood:432 |
Rv1725c hyp |
hypothetical protein | 416 | 416 | coexpression:416 |
Rv3095 |
HTH-type transcriptional regulator | 414 | 415 | coexpression:415 |
Rv0456A mazF1 |
toxin MazF1 | 555 | 402 | |
Rv1494 mazE4 |
antitoxin MazE4 | 477 | 400 | |
Rv1495 mazF4 |
mRNA interferase MazF4 | 864 | 339 | textmining:803 |
Rv1960c parD1 |
antitoxin ParD1 | 415 | 337 | |
Rv1103c mazE3 |
antitoxin MazE3 | 762 | 334 | textmining:659 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: mRNA interferase MazF6
- MTBC0 PGAP product: type II toxin-antitoxin system toxin endoribonuclease MazF6
- Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=2e-27)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216507.1)
- Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2337 - Curated reference: UniProt P9WII3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
mazE6 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002117|Rv1991c|mazF6 MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mazF6? Email the maintainer — the message is pre-filled with this gene's details.