Rv1687c Family assigned · medium auto-curated
H37Rv Rv1687c · MTBC0 mtbc0_001795 ·
255 aa · 1924168–1924935 (-) ·
RefSeq NP_216203.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ABC transporter ATP-binding protein |
|---|---|
| MTBC0 PGAP re-annotation | ABC transporter ATP-binding protein |
| Revised (this work) | ABC transporter ATP-binding protein. Pfam: ABC_tran (PF00005.34), AAA_21 (PF13304.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O33189
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved ATP-binding protein ABC transporter |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| eggNOG description | ABC transporter |
| Orthologous group | COG1131 |
| KEGG orthology |
K01990
|
| KEGG modules |
M00254
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.89 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 5 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (241) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC_tran | PF00005.34 | 7.7e-31 | 33–170 | ABC transporter |
AAA_21 | PF13304.13 | 3.6e-06 | 147–200 | AAA domain, putative AbiEii toxin, Type IV TA system |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1686c (ABC transporter permease), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1686c |
ABC transporter permease | 999 | 996 ctx | neighborhood:792 cooccurence:773 coexpression:890 textmining:931 |
Rv1685c hyp |
hypothetical protein | 979 | 811 ctx | neighborhood:651 textmining:897 |
Rv1688 mpg |
3-methyladenine DNA glycosylase | 788 | 789 ctx | neighborhood:787 |
Rv1349 irtB |
iron ABC transporter ATP-binding protein/permease IrtB | 709 | 697 | database:536 |
Rv1273c |
drug ABC transporter ATP-binding protein | 722 | 655 | database:536 |
Rv1272c |
drug ABC transporter ATP-binding protein | 744 | 654 | database:536 |
Rv1689 tyrS |
tyrosine--tRNA ligase | 644 | 644 ctx | neighborhood:600 |
Rv1348 irtA |
iron ABC transporter ATP-binding protein/permease IrtA | 654 | 632 | database:536 |
Rv0194 |
multidrug ABC transporter ATPase/permease | 634 | 614 | database:536 |
Rv2938 drrC |
daunorubicin ABC transporter permease DrrC | 662 | 551 | coexpression:407 |
Rv1217c |
tetronasin ABC transporter integral membrane protein | 838 | 526 ctx | cooccurence:422 textmining:673 |
Rv1305 atpE |
ATP synthase subunit C | 532 | 523 | |
Rv2937 drrB |
daunorubicin ABC transporter permease DrrB | 649 | 510 | coexpression:407 |
Rv1371 |
membrane protein | 527 | 500 | |
Rv0986 |
adhesion component ABC transporter ATP-binding protein | 506 | 481 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ABC transporter ATP-binding protein
- MTBC0 PGAP product: ABC transporter ATP-binding protein
- Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=8e-31), AAA_21 PF13304.13 (E=4e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216203.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), AAA_21 (PF13304.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1131 - Curated reference: UniProt O33189 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
Rv1686c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001795|Rv1687c| MMISSSDELLRDGADPAVIIDQLRVIRGKRLALQDVSVRVACGTITGLLGPSGSGKTTLIRCIVGSQIIASGSVSVLGQPAGSAELRHRVGYMPQDPTIYNDLRVIDNIRYFAELCGVDRQAADEVIEAVDLRDHRTARCANLSGGQRARVSLACALVGRPDLLVLDEPTIGLDPVLRVELWDRFTALARRGTTLLVSSHVMDEADRCGDLLLLRQGQLLAHTTPHRLRKETGCTSLEEAFLSIVRRTTTVPAAG