Rv1687c Family assigned · medium auto-curated

H37Rv Rv1687c · MTBC0 mtbc0_001795 · 255 aa · 1924168–1924935 (-) · RefSeq NP_216203.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ABC transporter ATP-binding protein
MTBC0 PGAP re-annotationABC transporter ATP-binding protein
Revised (this work)ABC transporter ATP-binding protein. Pfam: ABC_tran (PF00005.34), AAA_21 (PF13304.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33189 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved ATP-binding protein ABC transporter

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionABC transporter
Orthologous groupCOG1131
KEGG orthology K01990
KEGG modules M00254

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.89 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (241) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 7.7e-3133–170 ABC transporter
AAA_21PF13304.13 3.6e-06147–200 AAA domain, putative AbiEii toxin, Type IV TA system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1686c (ABC transporter permease), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1686c ABC transporter permease 999 996 ctx neighborhood:792 cooccurence:773 coexpression:890 textmining:931
Rv1685c hyp hypothetical protein 979 811 ctx neighborhood:651 textmining:897
Rv1688 mpg 3-methyladenine DNA glycosylase 788 789 ctx neighborhood:787
Rv1349 irtB iron ABC transporter ATP-binding protein/permease IrtB 709 697 database:536
Rv1273c drug ABC transporter ATP-binding protein 722 655 database:536
Rv1272c drug ABC transporter ATP-binding protein 744 654 database:536
Rv1689 tyrS tyrosine--tRNA ligase 644 644 ctx neighborhood:600
Rv1348 irtA iron ABC transporter ATP-binding protein/permease IrtA 654 632 database:536
Rv0194 multidrug ABC transporter ATPase/permease 634 614 database:536
Rv2938 drrC daunorubicin ABC transporter permease DrrC 662 551 coexpression:407
Rv1217c tetronasin ABC transporter integral membrane protein 838 526 ctx cooccurence:422 textmining:673
Rv1305 atpE ATP synthase subunit C 532 523
Rv2937 drrB daunorubicin ABC transporter permease DrrB 649 510 coexpression:407
Rv1371 membrane protein 527 500
Rv0986 adhesion component ABC transporter ATP-binding protein 506 481

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ABC transporter ATP-binding protein
  • MTBC0 PGAP product: ABC transporter ATP-binding protein
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=8e-31), AAA_21 PF13304.13 (E=4e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216203.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), AAA_21 (PF13304.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1131
  • Curated reference: UniProt O33189 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor Rv1686c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001795|Rv1687c|
MMISSSDELLRDGADPAVIIDQLRVIRGKRLALQDVSVRVACGTITGLLGPSGSGKTTLIRCIVGSQIIASGSVSVLGQPAGSAELRHRVGYMPQDPTIYNDLRVIDNIRYFAELCGVDRQAADEVIEAVDLRDHRTARCANLSGGQRARVSLACALVGRPDLLVLDEPTIGLDPVLRVELWDRFTALARRGTTLLVSSHVMDEADRCGDLLLLRQGQLLAHTTPHRLRKETGCTSLEEAFLSIVRRTTTVPAAG