Rv1686c Family assigned · medium auto-curated

H37Rv Rv1686c · MTBC0 - · 226 aa · 1911401–1912081 (-) · RefSeq NP_216202.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ABC transporter permease
MTBC0 PGAP re-annotation
Revised (this work)ABC transporter permease. Pfam: ABC2_membrane (PF01061.30), ABC2_membrane_3 (PF12698.14), ABC2_membrane_2 (PF12679.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O33188 TrEMBL · unreviewed · Inferred from homology
UniProt nameTransport permease protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionTransport permease protein
Orthologous groupCOG0842
KEGG orthology K01990, K01992
KEGG modules M00254

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.555 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC2_membranePF01061.30 3.3e-294–188 ABC-2 type transporter
ABC2_membrane_3PF12698.14 9.5e-2028–218 ABC-2 family transporter protein
ABC2_membrane_2PF12679.14 2.5e-0646–223 ABC-2 family transporter protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1687c (ABC transporter ATP-binding protein), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1687c ABC transporter ATP-binding protein 999 996 ctx neighborhood:792 cooccurence:773 coexpression:890 textmining:931
Rv1685c hyp hypothetical protein 986 965 ctx neighborhood:882 cooccurence:501 coexpression:449 textmining:638
Rv1218c tetronasin ABC transporter ATP-binding protein 917 745 ctx cooccurence:564 coexpression:408 textmining:689
Rv1688 mpg 3-methyladenine DNA glycosylase 728 728 ctx neighborhood:726
Rv1217c tetronasin ABC transporter integral membrane protein 878 637 ctx cooccurence:594 textmining:679
Rv1689 tyrS tyrosine--tRNA ligase 631 631 ctx neighborhood:631
Rv3131 NAD(P)H nitroreductase 556 540 coexpression:421
Rv2936 drrA daunorubicin ABC transporter ATP-binding protein DrrA 578 526 coexpression:405
Rv2032 acg NAD(P)H nitroreductase 538 522 coexpression:423
Rv1747 ABC transporter ATP-binding protein/permease 534 514 coexpression:405
Rv3127 hyp hypothetical protein 527 511 coexpression:421
Rv2938 drrC daunorubicin ABC transporter permease DrrC 501 501
Rv1863c integral membrane protein 502 484 coexpression:410
Rv2937 drrB daunorubicin ABC transporter permease DrrB 474 475
Rv1375 hyp hypothetical protein 488 457 coexpression:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): ABC transporter permease
  • Pfam (hmmscan --cut_ga): ABC2_membrane PF01061.30 (E=3e-29), ABC2_membrane_3 PF12698.14 (E=1e-19), ABC2_membrane_2 PF12679.14 (E=3e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216202.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC2_membrane (PF01061.30), ABC2_membrane_3 (PF12698.14), ABC2_membrane_2 (PF12679.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0842
  • Curated reference: UniProt O33188 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor Rv1687c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1686c|
MILLVPILIITLMYFMFENVPHRPGTPSGFNTACLVLLGLFPLFVMFVITAITMQRERASGTLERILTTPLRRLDLLAGYGTAFSIAAAAQATLACIVAFWFLGFDTAGSPVWVFAIAIVNAVLGVGLGLLCSAFARTEFQAVQFIPLVMVPQLLLAGIIVPRALMPTWLEWISNVMPASYALEALQQVGAHPELTGIAVRDVVVVLSFAVASLCLAAVTLRRRTS